[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09298.1"

            "GTP-binding protein LepA"
LEPA_RALME  "RecName: Full=GTP-binding protein lepA;"

OrgPattern 22222222222222222221221221233332323333223322222232222412221122322111 5744675666646444545-5655565555556666587843355445666535453655547534678665777676656654445554652555423555454645864444444444444456656666756444444444436664665455555555666445556565555565555665336645345555555545555555344445554446555555555665555555555555545555557766667767776666565666656655555555544455545545555555555654556655585646769677777776668588666668977567858868555755544644644555559777566786766867798888888888826656666678857998787888887756866666866766666666674476778445555554544554545455444453453665666665655565577677776677777755676866777865555566655555565546555555555555856697866555667689778998888888678544444454554453555443554444666758557666777777777777678767225766754455565665766666666666-66666666666666666666666755566666666666666667666666662766666666666245555555555586967545655655545555666566655589999998878999987776676677664777777777777776665655555878766756667665554544444433335-23434343334433433335435355545643 AB24DA62TF93A999AAB9BBA8BA9BB99997799A8979998988B8AA99779AAAAACA8789398879A894898AAA99AD-AE7ABCB9787888BFI2CDHJEOCDHF56787A8HF4I6Q*D1EFH6696M39E775545C66J7D88FANk9FA9AI9BTNCAC99DD*BB98BWJYW9HHEFCB98A -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDHIRNFSIIAHIDHGKSTLADRIIQRCGGLSDREMEAQVLDSMDIEKERGITIKAQTAA:Sequence :cTTEEEEEEEcccccEEEEEEcccccHcccccccccccccHHHHHHHHTTccEEEEccEE:Sec Str : ################ :PROS|42->57|PS00301|EFACTOR_GTP|PDOC00273| :============================================================:RP:SCP|1->174|1darA2|2e-37|36.1|144/254|c.37.1.8 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->178|PF00009|5e-31|46.5|170/183|GTP_EFTU 61: . . . * . .: 120 :LSYKARDGQVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI:Sequence :EEEEcTTccEEEEEEEEccccGGGHHHHHHHHHHccEEEEEEETTTcccTHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->174|1darA2|2e-37|36.1|144/254|c.37.1.8 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->178|PF00009|5e-31|46.5|170/183|GTP_EFTU 121: . . + . . .: 180 :ELGVEVVPVLNKIDLPQADPANAIQEIEDVIGIDAQDATPCSAKTGQGVEDVIEALIAKV:Sequence :HTTcEEEEEEEcTTcTTccHHHHHHHHHHHTccccTTcEEEcTTTcTTHHHHHHHHHHHc:Sec Str :====================================================== :RP:SCP|1->174|1darA2|2e-37|36.1|144/254|c.37.1.8 : =====================:RP:SCP|160->275|1n0uA1|3e-17|11.2|116/138|b.43.3.1 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->178|PF00009|5e-31|46.5|170/183|GTP_EFTU 181: . * . . . .: 240 :PPPKGDAAAPLQALIIDSWFDNYVGVVMLVRVVNGTLRPKDKVLLMATGAQHLVEQVGVF:Sequence :ccccccTTcccEEEEEEEEEETTTEEEEEEEEEEccEEcccEEEETTTccEEEccEEEEE:Sec Str : XXXXXXXXXX :SEG|204->213|vgvvmlvrvv :============================================================:RP:SCP|160->275|1n0uA1|3e-17|11.2|116/138|b.43.3.1 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 241: + . . . . *: 300 :SPKSIQRDELTAGQVGFVIAGIKELKAAKVGDTITTMTRRAEAPLPGFKEVKPQVFAGLY:Sequence :cccEEEccEEcTTcEEEEEcccccGGGccTTcEEEEcccccccccTTcccccccEEEEEE:Sec Str :=================================== :RP:SCP|160->275|1n0uA1|3e-17|11.2|116/138|b.43.3.1 : =========:RP:SCP|292->370|1fnmA4|8e-14|23.7|76/79|d.58.11.1 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 301: . . . . + .: 360 :PVESNQYEALRESLEKLRLNDASLQFEPEVSQALGFGFRCGFLGLLHMEIVQERLEREFD:Sequence :EccGGGHHHHHHHHHHHHTTccccEEEEEEETTTEEEEEEEEccHHHHHHHHHHHHHTcc:Sec Str : XXXXXXXXXXXXX :SEG|334->346|lgfgfrcgflgll :============================================================:RP:SCP|292->370|1fnmA4|8e-14|23.7|76/79|d.58.11.1 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 361: . . . * . .: 420 :MDLITTAPTVVYQVQQRDGTVLTVENPAKMPDPSKIEAILEPIVTVNLYMPQDYVGSVMT:Sequence :ccEEEcccEEcEEEEEccccEEEEccGGGcccGGGEEEEEEEEEEEEEEEEGGGHHHHHH:Sec Str :========== :RP:SCP|292->370|1fnmA4|8e-14|23.7|76/79|d.58.11.1 : ====================:RP:SCP|401->521|1n0uA5|8e-30|18.6|113/114|d.58.11.1 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|399->475|PF00679|3e-11|36.8|76/88|EFG_C 421: . . + . . .: 480 :LCTQKRGAQINMSYHGKQVQLTYEIPMAEIVMDFFDRLKSVSRGYASMDYEFKEYRQSDV:Sequence :HHHHTTcEEEEEEccTTEEEEEEEEEHHHHHTTTHHHHHHHTTcccEEEEEEEEEEEccE:Sec Str :============================================================:RP:SCP|401->521|1n0uA5|8e-30|18.6|113/114|d.58.11.1 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|399->475|PF00679|3e-11|36.8|76/88|EFG_C 481: . * . . . .: 540 :VKVDILINSDKVDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARE:Sequence :EEEEEEETTEEEEEEEEEEEGGGHHHHHHHHHHHHHHHcccccccEEEEEEETTEEEEEE:Sec Str :========================================= :RP:SCP|401->521|1n0uA5|8e-30|18.6|113/114|d.58.11.1 : =================================================:RP:SCP|492->590|1g7dA|2e-08|8.6|93/106|a.71.1.1 :============================================================:BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|487->595|PF06421|5e-36|63.3|109/109|LepA_C 541: + . . . . *: 600 :NVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGTVEIPQEAFLAILQVDDK :Sequence :EEccccTTcccccccHHHTTTcEEEEEEEcTTcccEEEEEEEEEGGGccccccc :Sec Str : XXXXXXXXXXXXX :SEG|561->573|kkkllekqkagkk :================================================== :RP:SCP|492->590|1g7dA|2e-08|8.6|93/106|a.71.1.1 :========================================================= :BL:SWS|1->597|LEPA_RALME|0.0|100.0|597/597 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|487->595|PF06421|5e-36|63.3|109/109|LepA_C