[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF09298.1 rmet0 ABF09298.1 "GTP-binding protein LepA"
MDHIRNFSIIAHIDHGKSTLADRIIQRCGGLSDREMEAQVLDSMDIEKERGITIKAQTAA
LSYKARDGQVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI
ELGVEVVPVLNKIDLPQADPANAIQEIEDVIGIDAQDATPCSAKTGQGVEDVIEALIAKV
PPPKGDAAAPLQALIIDSWFDNYVGVVMLVRVVNGTLRPKDKVLLMATGAQHLVEQVGVF
SPKSIQRDELTAGQVGFVIAGIKELKAAKVGDTITTMTRRAEAPLPGFKEVKPQVFAGLY
PVESNQYEALRESLEKLRLNDASLQFEPEVSQALGFGFRCGFLGLLHMEIVQERLEREFD
MDLITTAPTVVYQVQQRDGTVLTVENPAKMPDPSKIEAILEPIVTVNLYMPQDYVGSVMT
LCTQKRGAQINMSYHGKQVQLTYEIPMAEIVMDFFDRLKSVSRGYASMDYEFKEYRQSDV
VKVDILINSDKVDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARE
NVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGTVEIPQEAFLAILQVDDK
//