[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09387.1"

            "Lysine exporter protein (LYSE/YGGA)"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111-11----1-111---1----------1----------------------------------------------------------------------------------------------2------------------------------------------------1----------122------------------2---------12--1--211111111-11-1122----211---------------1-----------------------------1--11-111111222211222211122222-21312223-----1-1222-211111--1--31--------------11-------1--1---------------1----11-----------------------121-2-2211-1222211311121222222--------------1111-21111111111-11111-111111111111-111332121-11111111111111211-11111-211111111111--------------1121---------------223311-----1122122431333322211---------22231111123432------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASI:Sequence : ==============================================:BL:SWS|15->204|EAMB_SALTI|2e-21|29.9|184/195 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->205|PF01810|1e-07|28.5|179/190|LysE 61: . . . * . .: 120 :VALCTTGVGALILASPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAAL:Sequence :============================================================:BL:SWS|15->204|EAMB_SALTI|2e-21|29.9|184/195 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->205|PF01810|1e-07|28.5|179/190|LysE 121: . . + . . .: 180 :QYANIKAWMLALAVAASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLME:Sequence :============================================================:BL:SWS|15->204|EAMB_SALTI|2e-21|29.9|184/195 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|26->205|PF01810|1e-07|28.5|179/190|LysE 181: . * . . . .: 240 :GNRVRWFNGAMGLALALTAIWIAVAGQPH :Sequence :======================== :BL:SWS|15->204|EAMB_SALTI|2e-21|29.9|184/195 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|26->205|PF01810|1e-07|28.5|179/190|LysE