[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF09387.1 rmet0 ABF09387.1 "Lysine exporter protein (LYSE/YGGA)"
MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASI
VALCTTGVGALILASPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAAL
QYANIKAWMLALAVAASYMAGAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLME
GNRVRWFNGAMGLALALTAIWIAVAGQPH
//