[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09433.1"

            "Integrase, catalytic region"
            ""

OrgPattern -------------------------------------------------------------------- 1--7---B--1-----------------------------------------------------------------------------------------------------------------4----------------14------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-----------------1---2----5-----33-----132A-2---5---31-4--------------2---------------------------------1---------11326-7----111-----18-2----4----B-----1---------1-------------5--------2---1--4-------A-------1--------------------------2-------1---------------------------------------------6223B1156--2-618--12-221--A11-214---------------------1kiVdWYj-------------------------------------------------------------1----1------------------------------------------1-----------------------------------------------------H--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKTVCDVLGVARSAVAAKQARSSEWRDGRRARQYDDTALVAEIHELVAGLPTYGYRRVWA:Sequence : :Sec Str : =====================================================:BL:SWS|8->272|YI2A_ECOLX|3e-86|58.1|265/424 61: . . . * . .: 120 :LLRRSHELSGASPVNAKRVYRVMHDHQLLLRRPGRRLDTRRHDGRVAVDRSNTRWCSDGF:Sequence : ccccTTEEEEEEE:Sec Str : XXXXXXXXXXXXXX :SEG|88->101|lllrrpgrrldtrr :============================================================:BL:SWS|8->272|YI2A_ECOLX|3e-86|58.1|265/424 121: . . + . . .: 180 :EFRCDDGSPLRVTFALDCHDREAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIE:Sequence :EETTE ETTEEEEEEEETTTccEEEEEEccccHHHHHHHccHHHHHHHHHHHHHHccccE:Sec Str :============================================================:BL:SWS|8->272|YI2A_ECOLX|3e-86|58.1|265/424 181: . * . . . .: 240 :WLSDNGSAYIDHRTRSFARELGLEPLTTPVRSPQSNGMAESFVKTMKRDYIAFMNKPDVP:Sequence :EEccccTTTccHHHHHHHHHHTcEEEccccccccHHHHHHHHHHHHHHHHHHHHGGGccc:Sec Str : ==========================================================:RP:SCP|183->271|1b92A|9e-05|12.7|79/144|c.55.3.2 :============================================================:BL:SWS|8->272|YI2A_ECOLX|3e-86|58.1|265/424 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|183->227|PF00665|1e-05|40.0|45/116|rve 241: + . . . . *: 300 :TALSQLTVAFEQYNDWHPHKALKYRSPREFRRAATSST :Sequence :HHHHHHHHHHHHHHHHccGGGcccccHHHHH :Sec Str :=============================== :RP:SCP|183->271|1b92A|9e-05|12.7|79/144|c.55.3.2 :================================ :BL:SWS|8->272|YI2A_ECOLX|3e-86|58.1|265/424