[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF09433.1 rmet0 ABF09433.1 "Integrase, catalytic region"
MKTVCDVLGVARSAVAAKQARSSEWRDGRRARQYDDTALVAEIHELVAGLPTYGYRRVWA
LLRRSHELSGASPVNAKRVYRVMHDHQLLLRRPGRRLDTRRHDGRVAVDRSNTRWCSDGF
EFRCDDGSPLRVTFALDCHDREAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIE
WLSDNGSAYIDHRTRSFARELGLEPLTTPVRSPQSNGMAESFVKTMKRDYIAFMNKPDVP
TALSQLTVAFEQYNDWHPHKALKYRSPREFRRAATSST
//