[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09441.1"

            "DEAD/DEAH box helicase-like protein"
            ""

OrgPattern ---2-1223323333112--1--21--121-11111111111132232142232---2122221--12 1331433333332332322-25113422222243334555-52543533775545523--5533444685222223331141-11111766625443--6386748A937--------------2321343334231112111121332332211112323313214455311111111111151221--1135666666665666666436656666322535466666675333333333333333333435443553434344444434344223333333333333333333323333333333333333333333333-624766666667673522555545-2-122127555-1111----1-214-6434422213333444224433333333333333-4444444424524553434333433434544254455435555555546664333------------111111111111111111333325555466666665555667755654566655562455555655686654664463364333323253255584726263225333-555545665444487524--1-------1111111116111633BB8756D79BBBFEEEEEEEEEECEEDEDD1-2232311111165666666777667676-76668666877576666666666656666666666666565566666666751655667755667114522222444437559434344344344444222222222257786778877677777683222222226CCCBAAAAAADDCC44666666663333234-443333--------21322232---1--12---11121-11111111------35 TTNOYUT4*RPLTSVOQRQOOOOPPOPOOPPPPNNNPPNNNNNOONRRRRRQUTRRRSPQPPOPONOOHPONNOPOPKPQOOMNNMMO-NcQQSSVSOPOQPSbfdBX*W*lwkpkwZWXTYdVzvT*V**m3vk*UYZUpXbiVTabWTdTNyVjZVab*vibXUYlaf*kpkTMcdj*hfeScwo**T*tcbeZacg --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----

Master   AminoSeq   


1: . . . . + .: 60 :MTQHDFRAEQPIASATDAFATPADAASPLDKLDAMLNADAAPAVEASENGFAKLGLDAAI:Sequence : ccHHHHHTHHHHHHHHHHTTccGGGcHHHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|13->28|asatdafatpadaasp : ==========:BL:SWS|51->448|RHLE_ECOLI|5e-83|45.7|381/454 61: . . . * . .: 120 :LRALAEANYNTPTPVQAQAIPAFLAGRDLLVSSQTGSGKTAAFMLPAIQRISEKPATHRP:Sequence :HHHHHHHHHTcccccHHHHHHHHHTTTTEEEEccTTccHHHHTHHHHHHHTTccccEEcc:Sec Str :============================================================:RP:SCP|61->417|1pjrA1|2e-52|11.8|313/315|c.37.1.19 :============================================================:BL:SWS|51->448|RHLE_ECOLI|5e-83|45.7|381/454 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|73->254|PF00270|1e-36|50.9|161/167|DEAD 121: . . + . . .: 180 :TEPAKRMKGKRPRPSPAQPSLLVLTPTRELALQVTEAAAKYGRHLRRIVCASILGGMPYP:Sequence :EEccHHHHHHHTcTTccTccEEEEEccHHHHHHHHHTTHHHHHHTTTccEEEccTTccHH:Sec Str :============================================================:RP:SCP|61->417|1pjrA1|2e-52|11.8|313/315|c.37.1.19 :============================================================:BL:SWS|51->448|RHLE_ECOLI|5e-83|45.7|381/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|73->254|PF00270|1e-36|50.9|161/167|DEAD 181: . * . . . .: 240 :KQLAMLARMPDILVATPGRLLDHIEAGRIDLSALEMLVFDEADRMLDMGFADDIDAIVAA:Sequence :HHHHHHHccEEEEEHHHHHHHHHHccccccEEEEETHHHHHTTcccccEEccEEccTTTG:Sec Str : ######### :PROS|218->226|PS00039|DEAD_ATP_HELICASE|PDOC00039| :============================================================:RP:SCP|61->417|1pjrA1|2e-52|11.8|313/315|c.37.1.19 :============================================================:BL:SWS|51->448|RHLE_ECOLI|5e-83|45.7|381/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|73->254|PF00270|1e-36|50.9|161/167|DEAD 241: + . . . . *: 300 :TPASRQTLMFSATLDARIAQLASRQLRDPQRIEIAAARADHSNIEQRLHFTDDMSHKERL:Sequence :GGcccEEEEEEccccTTccHHHHHcccEEEEcccccccccEEcccEEEccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|61->417|1pjrA1|2e-52|11.8|313/315|c.37.1.19 :============================================================:BL:SWS|51->448|RHLE_ECOLI|5e-83|45.7|381/454 :$$$$$$$$$$$$$$ :RP:PFM|73->254|PF00270|1e-36|50.9|161/167|DEAD 301: . . . . + .: 360 :LDHLLRDASLKQAIVFTATKRDADSLAERLSDTGFSAGALHGDMTQGARNRTLTALRRGN:Sequence :HEHHHHHHHTccEEEEcccHHHHHHHHHHHHHTcccccEEccccHHHHHHHHTTTTcccc:Sec Str :============================================================:RP:SCP|61->417|1pjrA1|2e-52|11.8|313/315|c.37.1.19 :============================================================:BL:SWS|51->448|RHLE_ECOLI|5e-83|45.7|381/454 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|334->404|PF00271|2e-16|52.1|71/76|Helicase_C 361: . . . * . .: 420 :LRVLVATDVAARGIDVPDITHVVNFDLPKQAEDYVHRIGRTGRAGRSGVAINLVNHGDMF:Sequence :EEEEcTTccTTccccTTTccEEEEccccccTTHHHHHHHTccGGGcccEEEEEEEHHHHH:Sec Str :========================================================= :RP:SCP|61->417|1pjrA1|2e-52|11.8|313/315|c.37.1.19 :============================================================:BL:SWS|51->448|RHLE_ECOLI|5e-83|45.7|381/454 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|334->404|PF00271|2e-16|52.1|71/76|Helicase_C 421: . . + . . .: 480 :QWRRIERFTNNRIDASVIEGFEPRRSPKPRSNFGGKPGGRDGFRGNGGTGGGYRGNNGSG:Sequence :HHHHHHHHTTcccHHHHHHHHHHHccGGccc :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|452->490|nfggkpggrdgfrgnggtgggyrgnngsggyrgnregsg :============================ :BL:SWS|51->448|RHLE_ECOLI|5e-83|45.7|381/454 481: . * . . . .: 540 :GYRGNREGSGDRNFGERRFSSDNRGFGDRAPRPFGDDNRGGFGDRGERGFGDRSNGNSNG:Sequence : :Sec Str :XXXXXXXXXX :SEG|452->490|nfggkpggrdgfrgnggtgggyrgnngsggyrgnregsg : XXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|514->561|fgddnrggfgdrgergfgdrsngnsnggyrgqgqgqgqgqaqqrsfgg 541: + . . . . *: 600 :GYRGQGQGQGQGQAQQRSFGGERSFGNRDFAQRDGNRDATQRDGNRSFGGNRDGQRDGNR:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXX :SEG|514->561|fgddnrggfgdrgergfgdrsngnsnggyrgqgqgqgqgqaqqrsfgg : XXXXXXXXXXXX:SEG|589->600|ggnrdgqrdgnr 601: . . . . + .: 660 :SFGDRSFGDRKFGDRGGDRGGFGGQRNSRSRYER :Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXX :SEG|602->624|fgdrsfgdrkfgdrggdrggfgg