[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09446.1"

            "dihydrofolate reductase"
            ""

OrgPattern ------------------------2--22-21------------------------------------ -----11111111111111-11111111111111111111----11111--1121111----11-------11111111---------111111111--111111112111111111--11111------------------------------------------1----------------1-1------11111111111111111111111111111111111111111211111111111111112111111111111111111111111111111111111111111111111111111111111111111112111---11-------1-11-111111--111121------------------1--1111111111111111111111111111111111-11111111111111111111111111111---111111--------------11---------------11---------1-11-11111111111111111111111111111111121111111111211111111111112111111111111111121-1-1----------111-1111-----1------------------------------1111111111111111111111111111111-1111111-11111111111111111111-11112111111111111111111111111111111111311121111111111111111111111111111111111111111111111111111111111121111111111111121111111111111111111111111121112111111111111111111-1----------------111111------21---1-1211111-1------1--11 --11111--11---1-111----------------------------1111-11-1------11111--1--1111111111111111-12-1-111111111221311-3122212-----1111-2-492-225----1--11-----1-21--1112--1111-211111311111M111111--3-311112122 -------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------1--

Master   AminoSeq   


1: . . . . + .: 60 :MTLLTLIVARARNGVIGRNNTLPWRLPEDLQHFKRTTMGAPIIMGRKTWDSIGRPLPGRR:Sequence :cccEEEEEEEETTcEEEcTTccccccHHHHHHHHHHHHcccEEEEHHHHHHcGcccTTcE:Sec Str : ####################### :PROS|15->37|PS00075|DHFR_1|PDOC00072| : ==========================================================:RP:SCP|3->160|1ddrA|5e-62|42.0|157/160|c.71.1.1 :============================================================:BL:SWS|1->158|DYR_NEIGO|7e-43|50.6|158/162 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->159|PF00186|6e-47|57.4|155/158|DHFR_1 61: . . . * . .: 120 :NIVVTRNRDLHIEGADVVGSIEDAQRLCIGAEQVFLIGGAQLYAEALPSADRLIVTEIDA:Sequence :EEEEccccccccTTccEEEcHHHHHHHHTTEEEEEEcccHHHHHHHHccEEEEEEEEEcc:Sec Str :============================================================:RP:SCP|3->160|1ddrA|5e-62|42.0|157/160|c.71.1.1 :============================================================:BL:SWS|1->158|DYR_NEIGO|7e-43|50.6|158/162 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->159|PF00186|6e-47|57.4|155/158|DHFR_1 121: . . + . . .: 180 :DVEGDAFFPAVDRTTWVETARELHHSETNGFDYAFVTYERPASGEE :Sequence :cccccEEcccccTTTcEEcTTcTTccEETTEEEEEEEEEEEcHTc :Sec Str :======================================== :RP:SCP|3->160|1ddrA|5e-62|42.0|157/160|c.71.1.1 :====================================== :BL:SWS|1->158|DYR_NEIGO|7e-43|50.6|158/162 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->159|PF00186|6e-47|57.4|155/158|DHFR_1