[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09485.1"

            "GatB/Yqey"
            ""

OrgPattern -------------------------------------------------------------------- 11---11-111-1----11-1---1-111111----11111--1---------11-------1-1-111--1--------11---1111111-111---11111111111---------------11111111111-111111111-11---------------------1--------------------111111111111111111111111111111111111111111--------------------111-11-1111111111111111-----------------------------------------------11111111111111111--1111-11--1--1-11-1--111111111--1-------1--1111111111111111111111111-11111111111-111111111111111-1-11111111111111111-11--111-----------------------------111111111111-11111111111111111-11111111111111111111111111111111111111111111-11-----111111111111-1111-11111-11111111111-1---------11-111111-1111-1111111111111111111111--11111--------------------------------------------------------------------------------------------1111-11111111-1---------------1111111111-11111-------------11111111111111111111111111111111111111--1-111111------------------------------------1111-11-11111 --------------1--11----------------------------------------------1-1----------1----------1-------------111----------------------------------------------------------------------11--------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLKARINDDMKAAMRAREAERLGTVRLLLAAIKQREVDERIELDDAGITAVIDKMIKQR:Sequence :HHHHHHHHccccHHHHHHHHHHHHHcTTcTTHHHHHHHHTTcccHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXX :SEG|13->22|aamrareaer :============================================================:RP:SCP|1->147|1ng6A|3e-41|36.7|147/148|a.182.1.1 :============================================================:BL:SWS|1->147|YQEY_BACSU|3e-23|36.7|147/148 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->146|PF09424|3e-25|53.2|141/143|YqeY 61: . . . * . .: 120 :KDSISQFEQAGRDDLVAKEKAELDVLVAYMPAQLSDAEVAAEVQKAVTESGAAGPQDMGK:Sequence :HHHHHTTcccHHHHHHHHTHHHHHHHGTTccccccHHHHHHHHHHHHHHHccccccccHH:Sec Str :============================================================:RP:SCP|1->147|1ng6A|3e-41|36.7|147/148|a.182.1.1 :============================================================:BL:SWS|1->147|YQEY_BACSU|3e-23|36.7|147/148 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->146|PF09424|3e-25|53.2|141/143|YqeY 121: . . + . . .: 180 :VMGLVKARLAGRADMTAVSALVKAALAPK :Sequence :HHHHHHHHHTTTccHHHHHHHHHHHcc :Sec Str :=========================== :RP:SCP|1->147|1ng6A|3e-41|36.7|147/148|a.182.1.1 :=========================== :BL:SWS|1->147|YQEY_BACSU|3e-23|36.7|147/148 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->146|PF09424|3e-25|53.2|141/143|YqeY