[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09628.1"

            "dCTP deaminase"
DCD_RALME   "RecName: Full=Deoxycytidine triphosphate deaminase;         Short=dCTP deaminase;         EC=3.5.4.13;"

OrgPattern --11--11111111111111111-11111111111--------11111-----1---1-1---111-- 11-11-1111111111111-1111111111111111111111111111111111111111111-111111111111111-1--11111--------------------1-111111111111111-----------11111---111--1-1-11111111111111111-11111111111111-1111--------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1-------1--11---------------------------------1----------------------------------------111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111121111111111111211111111111111111---------------------------------1111111111111111111-111111----111-2-----------------------11111---------1--1-----------------------------------111----------------1-------1-111111111111---11111111111111--------1111---11111111111111111-1111111111111111111111--------------11111111111111--------------------------------------------------------1-- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1--------------1---------- ----------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSIKSDKWIRRMAEQHGMIEPFEPGQVRESDGRKIVSYGTSSYGYDIRCADEFKIFTNIN:Sequence : EEEEEccccEEEccEEEcTTccccEEEEEEEcccccEEEcTTccEEEEEEEEEEcccc:Sec Str : ==========================================================:RP:SCP|3->187|1xs1A|2e-52|27.7|173/193|b.85.4.1 :============================================================:BL:SWS|1->188|DCD_RALME|e-111|100.0|188/188 61: . . . * . .: 120 :STIVDPKNFDEKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGII:Sequence :ccccccccTTcccEEEEccccEEEcTTcEEEEEEcccccccTTEEEEEEccHHHHHTTEE:Sec Str :============================================================:RP:SCP|3->187|1xs1A|2e-52|27.7|173/193|b.85.4.1 :============================================================:BL:SWS|1->188|DCD_RALME|e-111|100.0|188/188 121: . . + . . .: 180 :VNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGCAQVLFFESDEICETSYADRGGKYQGQ:Sequence :EccEEEcEccTTcEEEEEEEcccccEEEcTTcEEEEEEEEEGGGEEccccTTEETTTTcc:Sec Str :============================================================:RP:SCP|3->187|1xs1A|2e-52|27.7|173/193|b.85.4.1 :============================================================:BL:SWS|1->188|DCD_RALME|e-111|100.0|188/188 181: . * . . . .: 240 :QGVTLPKT :Sequence :ccEE :Sec Str :======= :RP:SCP|3->187|1xs1A|2e-52|27.7|173/193|b.85.4.1 :======== :BL:SWS|1->188|DCD_RALME|e-111|100.0|188/188