[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09694.1"

            "6-phosphogluconate dehydrogenase, NAD-binding"
            ""

OrgPattern ------11222222211411111----1-1-------------1------1----1------11--11 124-132111111157521-15--3922222268783588252811221111549322--21313-7543211112111-1-4111-------------------1-2--------------------1-1-----43322---13221-222----11112211-11111-111---1-11-12112---2122232422223222223122222322222231222222211-------------------2-1-22-1---11--221111111-1----------11111111111------------------------1-11-------1-1-1---11------111--33-----1-1-------3123222-----429A72233633211231333224-22922B2B452-5554546866787722243422226571111111181122111-----------------------------32242-3A63A7999877222177AD666636A6G9A86-4553343335287782321--1331111111111222-22--221111--2-2-21222-111111--11-------------111-11-----1121223-222322222223222222222222---1112------2211-114334454544-34444444243433444414442211-4244434444434344132122331--11111111111----1111-1111133531113-2--1-1111133333241123-66663543433343323-1-1--1-1-311211111332221133233333------2---1111--------1-1------------------1----------------211 ----111-422-222755545446534222333333232333322233121598232221221---------1-1--------------11151112221111222-28345435331111122322416I2-33522212-222121222123132232234321132B111214342H232-356A73743385445 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTTVAFIGLGAMGAPMVGHLIRAGHTVRAFVRRPEAADAARQLGAEPFFTPAEAAQGAAV:Sequence :cccEEEEcccTTHHHHHHHHHHTTcEEEEEcccHHHHHHHHTTTcEEcccHHHHHHHccE:Sec Str : ############## :PROS|6->19|PS00895|3_HYDROXYISOBUT_DH|PDOC00697| : =========================================================:RP:SCP|4->162|1vpdA2|1e-43|40.9|159/161|c.2.1.6 : =========================================================:BL:SWS|4->287|GLXR_ECOLI|3e-54|40.3|283/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->162|PF03446|1e-28|50.3|159/160|NAD_binding_2 61: . . . * . .: 120 :VFTNVTSSEDVREVLLGRNGVVEGAAPGTICVDHSTISPIVTREIAQALAACGIEALDCP:Sequence :EEEccccHHHHHHHHTcTTcHHHHccTTcEEEEcccccHHHHHHHHHHHHHTTcEEEEcc:Sec Str :============================================================:RP:SCP|4->162|1vpdA2|1e-43|40.9|159/161|c.2.1.6 :============================================================:BL:SWS|4->287|GLXR_ECOLI|3e-54|40.3|283/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->162|PF03446|1e-28|50.3|159/160|NAD_binding_2 121: . . + . . .: 180 :VSGGTVGAQAATLTIMVGGKAEVLEKVRPLLEQIGKTITHIGDSGAGQVAKLCNQIAQVV:Sequence :EEcHHHHHHHTcEEEEEEccHHHHHHHHHHHHHHEEEEEEEEcTTHHHHHHHHHHHHHHH:Sec Str :========================================== :RP:SCP|4->162|1vpdA2|1e-43|40.9|159/161|c.2.1.6 : ================:RP:SCP|165->286|1wp4A1|9e-22|23.8|122/132|a.100.1.1 :============================================================:BL:SWS|4->287|GLXR_ECOLI|3e-54|40.3|283/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->162|PF03446|1e-28|50.3|159/160|NAD_binding_2 181: . * . . . .: 240 :NIEGIAEAMRFAGAQGVDTAKVFQAMSTGMAGSRMLDMLGPKMVTRDFSAGIESRLHAKD:Sequence :HHHHHHHHHHHHHHTTccHHHHHHHHHTcTTccHHHHHHcccccTccccccccHHHHHHH:Sec Str :============================================================:RP:SCP|165->286|1wp4A1|9e-22|23.8|122/132|a.100.1.1 :============================================================:BL:SWS|4->287|GLXR_ECOLI|3e-54|40.3|283/292 241: + . . . . *: 300 :FGLAADIATEIGLELPAMRATSAQLGELMDQGWGKDDTSSLLKVLELKG :Sequence :HHHHHHHHHHHTcccHHHHHHHHHHHHHHHTTcTTccGGGGHHHHHHHH :Sec Str :============================================== :RP:SCP|165->286|1wp4A1|9e-22|23.8|122/132|a.100.1.1 :=============================================== :BL:SWS|4->287|GLXR_ECOLI|3e-54|40.3|283/292