[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09846.1"

            "leucyl-tRNA synthetase"
SYL_RALME   "RecName: Full=Leucyl-tRNA synthetase;         EC=6.1.1.4;AltName: Full=Leucine--tRNA ligase;         Short=LeuRS;"

OrgPattern 33-22143233333422-11-1-34334342333333333333332332334323444434212221- 1321232222222233322-23222322222222222333211123122222333234112331322212232222222211243433222223223122222222322222222222222222222221322312222331123333333333322323232333323333333333333332222233234455555554455555444444455444443443333333334444444444444454444233344334443322443433233334443444333333333333333333323333333333333333343231333333313131223222234324324233443453444444323231222233333433444233244433333333333-3333333223444223333443334422222222223223333333322233222222332222232221232222222323232333432111222222232332222233332222222222222222222223231212222222222222222222222222223222112132342222323224222212222111112122222122222222222222222222222222222222222222212222212222223222222222222222-22322222222222222222222222222222222222222222222222221222222222222222233333222222223222222222221222222322222222222222222222212222222222222222222222222222222222222222223232222122221221231344334-33423323333422323333223333333222 2311442-31111121134322233342212223322444334222433532432232211131333311443314415441222234-1-31222332211133312746454437222225254242IY51543322253142322123124234334AF25442311124344234S4452242524355554444 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVR:Sequence :EEccccHHHHHHHHHHHHHHHTcccccccHTTccTTcEEEEEEccTcccccccccHHHHH:Sec Str : ############ :PROS|48->59|PS00178|AA_TRNA_LIGASE_I|PDOC00161| : ==============================================:RP:SCP|15->396|1f9dA|2e-50|7.9|353/629|a.102.1.2 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 61: . . . * . .: 120 :NYTINDVMARYLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQS:Sequence :HHHHHHHHHHHHHHTTcEEEcccccccccHHHHHHHHHTTccHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|15->396|1f9dA|2e-50|7.9|353/629|a.102.1.2 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 121: . . + . . .: 180 :MGLAIDWSREVATCSPEYYRWNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDG:Sequence :TTccccGGGcccTTcHHHHHHHHHHHHHHHHTTcEEEEEEEEEEETTTTEEEcGGGcTTc:Sec Str :============================================================:RP:SCP|15->396|1f9dA|2e-50|7.9|353/629|a.102.1.2 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 181: . * . . . .: 240 :RGWRSGAVVEKREIPMYYLRITDYAQELLGDLEGLGWPERVKIMQQNWIGRSEGVRFAFP:Sequence :ccccTTcccEEEEEEEEEEcGGGGHHHHHHTTTTccccHHHHHHHHHHHccEEEEEEEEE:Sec Str :============================================================:RP:SCP|15->396|1f9dA|2e-50|7.9|353/629|a.102.1.2 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 241: + . . . . *: 300 :HEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPLATHAAESNPALAAFIEECKH:Sequence :cccHccHHHcccccEEEEEEccGGGGGGccEEEEcTTcTHHcccHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|15->396|1f9dA|2e-50|7.9|353/629|a.102.1.2 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 301: . . . . + .: 360 :GSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMGVPAHDERDFA:Sequence :ccHHHHTTcTTccccEEEEEEEEcTTTccEEEEEEcTTccTTcTTcEEEEcGGGcHHHHH:Sec Str :============================================================:RP:SCP|15->396|1f9dA|2e-50|7.9|353/629|a.102.1.2 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 361: . . . * . .: 420 :FALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYKAAVDAIAADLA:Sequence :HHHHTTccccccEEcccccccccHHccHcccccccEEcccGGGTTccHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX:SEG|409->425|kaavdaiaadlaakglg :==================================== :RP:SCP|15->396|1f9dA|2e-50|7.9|353/629|a.102.1.2 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 421: . . + . . .: 480 :AKGLGEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTG:Sequence :HHTcEEEEEEccccccccEEcccccccccEEEETTTEEEEcccTTcccccccHHHccccc:Sec Str :XXXXX :SEG|409->425|kaavdaiaadlaakglg : ==================================================:RP:SCP|431->685|1h3nA3|2e-53|47.8|255/494|c.26.1.1 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 481: . * . . . .: 540 :NPLAKDPRFLECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPM:Sequence :cGGGGcHHHHEEEccccccEEEccccEEcHHHHTTTHHHHTTcTcccccccHHHHHHccc:Sec Str :============================================================:RP:SCP|431->685|1h3nA3|2e-53|47.8|255/494|c.26.1.1 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 541: + . . . . *: 600 :DQYIGGIEHAILHLLYARFWTKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKT:Sequence :cEEEEcGGGTTTHHHHHHHHHHHHHHTTcccccccccccEEcccEEEcEEEEEEEEETTE:Sec Str :============================================================:RP:SCP|431->685|1h3nA3|2e-53|47.8|255/494|c.26.1.1 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 601: . . . . + .: 660 :WYNPADVDVQTDERGRPAGATAKADGQPVVIGGIEKMSKSKNNGIDPQALIDQYGADTAR:Sequence :EEccHHHHHHHcccccEEEHHHHHHTTcEEEEEcccccTTTTccccHHHHHHHccHHHHH:Sec Str :============================================================:RP:SCP|431->685|1h3nA3|2e-53|47.8|255/494|c.26.1.1 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 661: . . . * . .: 720 :LFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNYGYANAQAIRDGAGTAPTADDAALRREI:Sequence :HHHHccccTTccEEEcHHHHHHHHHHHHHHHHHHHHTHHHHHccccTTccTHHHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|703->715|dgagtaptaddaa :========================= :RP:SCP|431->685|1h3nA3|2e-53|47.8|255/494|c.26.1.1 : ======================================:RP:SCP|683->830|1ileA1|1e-18|17.1|146/180|a.27.1.1 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$ :RP:PFM|15->668|PF00133|1e-59|39.5|524/593|tRNA-synt_1 : $:RP:PFM|720->831|PF08264|1e-05|36.1|108/153|Anticodon_1 721: . . + . . .: 780 :HTVLKQANYDYERIQYNTVVSATMKMLNALEDAKTASPAGRREGFSVLLRVLYPVVPHIA:Sequence :HHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHTTTcHHHH:Sec Str :============================================================:RP:SCP|683->830|1ileA1|1e-18|17.1|146/180|a.27.1.1 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|720->831|PF08264|1e-05|36.1|108/153|Anticodon_1 781: . * . . . .: 840 :HGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVLQVNGKVRGSLTVPADADRAAIE:Sequence :HHHHHTTccccHHHcGGGTccccccHHHHccccEEEEEEETTEEEEEEEEc :Sec Str : XXXXXXXXX:SEG|832->850|adadraaieataaaseiva :================================================== :RP:SCP|683->830|1ileA1|1e-18|17.1|146/180|a.27.1.1 :============================================================:BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|720->831|PF08264|1e-05|36.1|108/153|Anticodon_1 841: + . . . . *: 900 :ATAAASEIVAKFAAGAAPKKIVVVPGRLVNVVL :Sequence : :Sec Str :XXXXXXXXXX :SEG|832->850|adadraaieataaaseiva : XXXXXXXXXXX :SEG|862->872|vvvpgrlvnvv :===================== :BL:SWS|1->861|SYL_RALME|0.0|100.0|861/873