[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF09882.1"

            "TniB"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------1------------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-------------3--------------------1------51--2------1----------1--1------------------1--------------------------------1---------1111------------------31-113--24----4--1------------------2--------------------------1--1-----------------------------2----11-2---1-------------------------------------------------------------------------------------------------1-------------------------1--------------2----1---------2--211-------------------111----------1------------------1-------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEEYPIIDLSHLLPAAQGLARLPADERIHRLRADRWIGYPRAVEALNRLEILYTWPNKQR:Sequence : cccE:Sec Str : $$$$$$:RP:PFM|55->282|PF05621|2e-51|55.3|228/248|TniB 61: . . . * . .: 120 :MPNLLLVGPTNNGKSMIVEKFRRTHPARADADQEHIPVLVVQMPSEPSVIRFYVALLAAM:Sequence :EEEEEEEccccccHHHHHHHHHTccEEEccccccc :Sec Str : XXXXXX:SEG|115->131|allaamgaplrprprlp :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->282|PF05621|2e-51|55.3|228/248|TniB 121: . . + . . .: 180 :GAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAGNSVNRREFLNLLRFLGNELR:Sequence : :Sec Str :XXXXXXXXXXX :SEG|115->131|allaamgaplrprprlp : XXXXXXXXXXXXXXXXX:SEG|164->180|nrreflnllrflgnelr : =================================================:BL:SWS|132->208|CLPB_THET8|3e-04|33.8|77/854 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->282|PF05621|2e-51|55.3|228/248|TniB 181: . * . . . .: 240 :IPLVGVGTRDAYLAIRSDDQLENRFEPMMLPVWEANHDCCSLLASFAASLPLRRPSSIAT:Sequence : :Sec Str : XXXXXXXXXX :SEG|221->230|sllasfaasl :============================ :BL:SWS|132->208|CLPB_THET8|3e-04|33.8|77/854 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->282|PF05621|2e-51|55.3|228/248|TniB 241: + . . . . *: 300 :LDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEAINHRTLSMADYTGPSERRRQFERE:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|55->282|PF05621|2e-51|55.3|228/248|TniB 301: . . . . + .: 360 :LM :Sequence : :Sec Str