[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE37362.1 rpal2 ABE37362.1 "hypothetical protein"
MHLVVCTGCREDVAQLIGNQIGSVDRWFEQRARHFVQNATDRLQRIGVEWRGGEYDRMRV
TSGAPQRGESTMRTESNRYFTIEQLEELAVAKYIEAALMPEGGEREELLQEAKRFASRAR
MKSWLMGEIGITPPRREYH
//