[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE37468.1"

            "SSU ribosomal protein S15P"
RS15_RHOPS  "RecName: Full=30S ribosomal protein S15;"

OrgPattern -------------------------------------------------------------------- 111111--111-1-11111-11111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111-----11111111111111111111-111111111111111111-111111111111-1111111111-111111111111111111111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-111111111111111111111111111111111111111111111111111111-11111-11---1-111111111111111-1111111111111111111111111111-111111111111111111111111111111111111-11111111111111111111111112111111111111111111111111111111111111111111111111111111-1111111111111111111-1-11--11111111111-1111-1-111111-111111-111111111111111-11 -------1----11--------------------------------------------------------1-------------------------------1112--------------------------------------------------------------------1111-7111221--2---22----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLV:Sequence : cccHHHHHHHHHHHcccccccccTTHHHHHHHHHHTTTTTTTTTcTTccTTcHHHHHHH:Sec Str : ######################:PROS|39->69|PS00362|RIBOSOMAL_S15|PDOC00313| : ==========================================================:RP:SCP|3->87|1a32A|2e-22|54.1|85/85|a.16.1.2 :============================================================:BL:SWS|1->89|RS15_RHOPS|2e-46|100.0|89/89 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->84|PF00312|6e-15|57.0|79/83|Ribosomal_S15 61: . . . * . .: 120 :STRRSLLDYVKKKDEARYKALLEKHNIRR :Sequence :HHHHHHHTTHHHHccHHHHTTTTTTTccc :Sec Str :######### :PROS|39->69|PS00362|RIBOSOMAL_S15|PDOC00313| :=========================== :RP:SCP|3->87|1a32A|2e-22|54.1|85/85|a.16.1.2 :============================= :BL:SWS|1->89|RS15_RHOPS|2e-46|100.0|89/89 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->84|PF00312|6e-15|57.0|79/83|Ribosomal_S15