[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE37468.1 rpal2 ABE37468.1 "SSU ribosomal protein S15P"
MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLV
STRRSLLDYVKKKDEARYKALLEKHNIRR
//