[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE37597.1"

            "ribosomal large subunit pseudouridine synthase D"
            ""

OrgPattern --------------------------------------11111------------------------- 2121111222221211111-11111111111111112111111111211111111111111111111111111111112111111222444414-211112112232324-2222222-211114111111111112222111121123233211223322213112112113111113111123311221433-3333333333333322333333333333223333334533333333333333333333-34344343334444444443333333333333333333333333333333333333333333333333332333333222232343222222324322232133141121212223132213333322222333223332322222222222223-323333332232233222222222334433333333333333333333333334222222222331122222222222222-222333332222222232222222222222222222222222222243424423232333322244233333322225431224362234221233333432475779524332122222223232333234333322444443447535888889866688-888792-3222322122244444554444444444-44444444444444444444444444543444444444444445444444431544444444444222422222222233524444455444454444444344434436333333333-33333332222222225777466666557664433333333222222433311111111121121211111-11111211111122111112212222222232 ----122-1111--11111---------------------------11-11111--1-11-12112221-22111-22-211211111-22112--1-1111121-1263412111--11-11-12-1-241-112----1121111---211311-11-122221-31-2-1-11235G966-321161627641114 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVAGGGGGDDARPLRQPQRGLGGDRNASLGAEKLIADGDENRRERQRRGQARDHHHPPHP:Sequence : :Sec Str : XXXXXXXXXXXXXXXX :SEG|37->52|dgdenrrerqrrgqar 61: . . . * . .: 120 :RKQRGLFGGRFGQGGFGHAMLGFGSVFLEGSIVNDSSGHLLEVVVAGDEGSPRLDRVLAT:Sequence : cTTTTTTHHcccEEHHHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|63->77|qrglfggrfgqggfg : ===================================:RP:SCP|86->213|1fjgD|5e-11|17.1|123/208|d.66.1.2 : ========:BL:SWS|113->418|RLUD_ZYMMO|2e-61|49.1|289/317 121: . . + . . .: 180 :RCPALSRSRLKALILDGRVAIRGAPVRDPAYHAASGETITIDVPPPVAPEPAGEAIALEI:Sequence :TTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEEccccGGGccEEEEEc:Sec Str : XXXXXXXXXXXXXXX :SEG|163->177|vpppvapepageaia : XX:SEG|179->191|eivhedddiivid :============================================================:RP:SCP|86->213|1fjgD|5e-11|17.1|123/208|d.66.1.2 :============================================================:BL:SWS|113->418|RLUD_ZYMMO|2e-61|49.1|289/317 181: . * . . . .: 240 :VHEDDDIIVIDKPRGLVVHPAAGHETGTLVNALIAHCGESLSGIGGVRRPGIVHRLDKDT:Sequence :cccccEEEETTEcTTcccccccccTTcHHHHHTcccccEHHHHHTcccccEEcccccccc:Sec Str :XXXXXXXXXXX :SEG|179->191|eivhedddiivid : ########:PROS|233->247|PS01129|PSI_RLU|PDOC00869| :================================= :RP:SCP|86->213|1fjgD|5e-11|17.1|123/208|d.66.1.2 : =================================================:RP:SCP|192->418|1v9kA|1e-50|34.5|203/227|d.265.1.3 :============================================================:BL:SWS|113->418|RLUD_ZYMMO|2e-61|49.1|289/317 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->350|PF00849|1e-21|48.2|141/149|PseudoU_synth_2 241: + . . . . *: 300 :TGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGAPNRIRGTIDAPIDRHPHARE:Sequence :EEEEEEEccTHHHHHHHcGGGcccEETTccEEEEEEEcccccHHHHHHHHcccHHHHHHH:Sec Str :####### :PROS|233->247|PS01129|PSI_RLU|PDOC00869| :============================================================:RP:SCP|192->418|1v9kA|1e-50|34.5|203/227|d.265.1.3 :============================================================:BL:SWS|113->418|RLUD_ZYMMO|2e-61|49.1|289/317 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|192->350|PF00849|1e-21|48.2|141/149|PseudoU_synth_2 301: . . . . + .: 360 :KMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLAHIGHPLLGDD:Sequence :HTcccccccccccEEEEccccccccEEEEccEEEEEEccccTTHHHHHHHHTTccEEEEE:Sec Str :============================================================:RP:SCP|192->418|1v9kA|1e-50|34.5|203/227|d.265.1.3 :============================================================:BL:SWS|113->418|RLUD_ZYMMO|2e-61|49.1|289/317 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|192->350|PF00849|1e-21|48.2|141/149|PseudoU_synth_2 361: . . . * . .: 420 :VYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHPSTGEVVAWESGLPADLKRLKA:Sequence :EEEEEEEEEETTEEGGGcccHHEETTEEcTTccTTcEEEccHHHHHHHHHTcccccccHH:Sec Str :========================================================== :RP:SCP|192->418|1v9kA|1e-50|34.5|203/227|d.265.1.3 :========================================================== :BL:SWS|113->418|RLUD_ZYMMO|2e-61|49.1|289/317 421: . . + . . .: 480 :ALTATE :Sequence :HHHH :Sec Str