[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE37597.1 rpal2 ABE37597.1 "ribosomal large subunit pseudouridine synthase D"
MVAGGGGGDDARPLRQPQRGLGGDRNASLGAEKLIADGDENRRERQRRGQARDHHHPPHP
RKQRGLFGGRFGQGGFGHAMLGFGSVFLEGSIVNDSSGHLLEVVVAGDEGSPRLDRVLAT
RCPALSRSRLKALILDGRVAIRGAPVRDPAYHAASGETITIDVPPPVAPEPAGEAIALEI
VHEDDDIIVIDKPRGLVVHPAAGHETGTLVNALIAHCGESLSGIGGVRRPGIVHRLDKDT
TGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGAPNRIRGTIDAPIDRHPHARE
KMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLAHIGHPLLGDD
VYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHPSTGEVVAWESGLPADLKRLKA
ALTATE
//