[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE37664.1"

            "protein of unknown function DUF299"
Y426_RHOPS  "RecName: Full=Putative phosphotransferase RPD_0426;         EC=2.7.-.-;"

OrgPattern -------------------------------------------------------------------- -----------------------------------------------1-----1---------1---------------111------------------------------------------------------111------1-------------------------------------111-----111111111111111111111111111111111122222212211111111111111222222111111-11111--11211------1111---1--------------------------1--------1-11-11111111111-1---1-1-1-221--111111121111111-------111111111111111111111111111111111-11111111111-11111111111111111----------11111111111-11111111111111--1111111111111111111111-111111111111111111111111111111111111111111111111111111111111111112111111-1-2----------111111111-----1-----------------------------11111-1111-1111111111111111111--1-111------11111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1111---1-----1111-1111---------------11111111111-11111111111111111-------------1111111111111111111111111----------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11181-1--1112-211------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLVRSQKQLDRVLQEIEE:Sequence : :Sec Str :============================================================:BL:SWS|1->279|Y426_RHOPS|e-155|100.0|279/279 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->266|PF03618|5e-56|41.1|253/255|DUF299 61: . . . * . .: 120 :SPGIVLFTLLESELVNRLEAKCQQINSPSLSIIGPVMQLFEAYLGASTTGRVGAQHTLNA:Sequence : TccccccTTTTcccHH:Sec Str :============================================================:BL:SWS|1->279|Y426_RHOPS|e-155|100.0|279/279 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->266|PF03618|5e-56|41.1|253/255|DUF299 121: . . + . . .: 180 :EYFKRIDALNYSMMHDDGQHVEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVA:Sequence :HHHHHHHHHTccTTTcTTHHHHcHHHHHHHHHHHHHcccTTccHHHHHTTcccccHHHHH:Sec Str : =================================================:RP:SCP|132->274|1lwdA|2e-04|15.9|138/413|c.77.1.1 :============================================================:BL:SWS|1->279|Y426_RHOPS|e-155|100.0|279/279 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->266|PF03618|5e-56|41.1|253/255|DUF299 181: . * . . . .: 240 :GIPIPHQLETLKKPLVVSLHASPDRLIQVRQNRLLSLGAGAGNDSYIDRQAVTDEVLLAR:Sequence :TTccc :Sec Str :============================================================:RP:SCP|132->274|1lwdA|2e-04|15.9|138/413|c.77.1.1 :============================================================:BL:SWS|1->279|Y426_RHOPS|e-155|100.0|279/279 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->266|PF03618|5e-56|41.1|253/255|DUF299 241: + . . . . *: 300 :KLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE :Sequence : :Sec Str :================================== :RP:SCP|132->274|1lwdA|2e-04|15.9|138/413|c.77.1.1 :======================================= :BL:SWS|1->279|Y426_RHOPS|e-155|100.0|279/279 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|12->266|PF03618|5e-56|41.1|253/255|DUF299