[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE37664.1 rpal2 ABE37664.1 "protein of unknown function DUF299"
MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLVRSQKQLDRVLQEIEE
SPGIVLFTLLESELVNRLEAKCQQINSPSLSIIGPVMQLFEAYLGASTTGRVGAQHTLNA
EYFKRIDALNYSMMHDDGQHVEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVA
GIPIPHQLETLKKPLVVSLHASPDRLIQVRQNRLLSLGAGAGNDSYIDRQAVTDEVLLAR
KLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE
//