[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE37710.1"

            "protein of unknown function DUF589"
            ""

OrgPattern ------------------------------------------------------------------11 -11------------------------------------------------------------------------------------1-----------------111-1--------------------------11111---1----1---11--------1-11------11--1----111-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1-1---111111111111111111111111111111-11111111111111111111111111-1-11111111111111111111111111--111111-----------------1-1111111------1111111-11111111111111111111--1111--111-1-1-11-11-1---------111-111-----1111-111111111111111111----------------------------11---111--11-11111---1111-1--1------111--------------------------------------------------------------------------------------------111111----1-1-1-----------------------1--11111-11111111-111-------------1-----111-11111111111-111------1111-----------------------------------------------1- --------211--------1--11-1----------------1-----11------1----------------1----------------------------------1-1-------1---111--21333-1-1----1-111-----1--1----1-----1----------111-6---1111-1-1-------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNEGKEI:Sequence :ccEEEEEEcTTTccHHHHHHHcETcEEccccccHHHHHHHHHccTTcEEEEEEccccccE:Sec Str : XXXXX:SEG|56->70|egkeiigiaeiirea : ==========================================================:RP:SCP|3->137|1zceA1|5e-41|46.7|135/146|b.122.1.8 : ===========================================================:BL:SWS|2->134|THYN1_HUMAN|1e-11|33.8|133/225 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->134|PF01878|2e-25|47.7|130/142|DUF55 61: . . . * . .: 120 :IGIAEIIREAYPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSV:Sequence :EEEEEEEEEEEEcGGccccccEEEEEEEEEEEEEEEEHHHHTTcGGGTTcHHHHcccccE:Sec Str :XXXXXXXXXX :SEG|56->70|egkeiigiaeiirea :============================================================:RP:SCP|3->137|1zceA1|5e-41|46.7|135/146|b.122.1.8 :============================================================:BL:SWS|2->134|THYN1_HUMAN|1e-11|33.8|133/225 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->134|PF01878|2e-25|47.7|130/142|DUF55 121: . . + . . .: 180 :QPVTADEWKLICKMGGL :Sequence :EEEcHHHHHHHHHHHHc :Sec Str :================= :RP:SCP|3->137|1zceA1|5e-41|46.7|135/146|b.122.1.8 :============== :BL:SWS|2->134|THYN1_HUMAN|1e-11|33.8|133/225 :$$$$$$$$$$$$$$ :RP:PFM|3->134|PF01878|2e-25|47.7|130/142|DUF55