[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE37710.1 rpal2 ABE37710.1 "protein of unknown function DUF589"
MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNEGKEI
IGIAEIIREAYPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSV
QPVTADEWKLICKMGGL
//