[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE37723.1"

            "beta-Ig-H3/fasciclin"
            ""

OrgPattern -------------------------------------------1--3--1212--------------- 1-2-1--1---------22-22--1-22222-2222-111----1-------121-------1-----14-----------------------------2-1-34-1231-------------------------------111--22422214322------22146642------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1-11------12322---11111----------1-11-11-1--2--111121111111---4122-111132---------1-------------------------------------32-2-1-------------------------1---1----11--1111111----1-----------------------------------------1-1-----------------------------------------1---1-------------------------------------------------------------------------------------------------------1----------------------------1----------------------221---------1----------------------1-----1-1--1111111111--------11---------------------------------------------------1- ------4----------11--------------------------------2-11-1-1---------------------------------------------1---1-G1221442222221652427P2-725122151111112213113---21-----57---1---3--1--1---121---1--41----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKRIAYLSAAALSALALTATAMAPANAEDKKMMKSEMSGEKTVMVGGAPMYPSKNIVEN:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXX :SEG|6->28|aylsaaalsalaltatamapana : XXXXXXXXXXXX :SEG|31->42|kkmmksemsgek : ==================:BL:SWS|43->193|Y1483_SYNY3|2e-25|43.4|145/180 61: . . . * . .: 120 :AVNSKDHSTLVAAVKAAGLVKTLEGKGPFTVFAPTNAAFGKLPAGTVDTLVKPESKATLT:Sequence : TcccccEEEcccHHHHHHccTTHHHHHHcTHHHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|69->83|tlvaavkaaglvktl : ==================================:RP:SCP|87->193|1nyoA|8e-26|44.9|98/163|b.118.1.1 :============================================================:BL:SWS|43->193|Y1483_SYNY3|2e-25|43.4|145/180 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|85->193|PF02469|2e-15|53.4|103/129|Fasciclin 121: . . + . . .: 180 :KILTYHVVPGKLAAADLTDGKKLTTVEGATLTVKRSGDQVMLVDAKGGSSTVTIPNVNQS:Sequence :HTHHHHcccccccHHHHcccEEEEETTTEEEEEEcTTccEETTccEETTccccccccccc:Sec Str :============================================================:RP:SCP|87->193|1nyoA|8e-26|44.9|98/163|b.118.1.1 :============================================================:BL:SWS|43->193|Y1483_SYNY3|2e-25|43.4|145/180 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|85->193|PF02469|2e-15|53.4|103/129|Fasciclin 181: . * . . . .: 240 :NGVIHVVDTVLMPS :Sequence :ccEEEccccccccc :Sec Str :============= :RP:SCP|87->193|1nyoA|8e-26|44.9|98/163|b.118.1.1 :============= :BL:SWS|43->193|Y1483_SYNY3|2e-25|43.4|145/180 :$$$$$$$$$$$$$ :RP:PFM|85->193|PF02469|2e-15|53.4|103/129|Fasciclin