[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE37731.1"

            "aspartate semialdehyde dehydrogenase"
            ""

OrgPattern 11-1--2322222222-11111121111111111111111111-111111111111111-211-1-11 2211211111111111111-11111111111111111111121111111111-111-111221111122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222222212222321111112221111111111111111111111111111111111111-1111111-121111-11111111111111111111111111111-------------111111111111122111111111111111111111-111111111111121111111-1111222111111112221111111111111111111-111111111121111111111111111111111111111111111111111111111111122111111111111111111111111111-----1111111111111111111-1111-1-111111---11111---111111122111111111111111111111111111122222121222222112111111111111111111111111111221211111221111111111111111111--1111111111122222222222222222-2222222222222222222333222222222222222222222222222222-22222222222211211111111111211122221222222211211111111112122222222222222222111--1111122222222222222111111111111111111111111----------1-------------------------1111111111111 ------1-----111-------1----1111-1-11-11111111-11------11-11---1111111-1111111-111111111--121---11111-11111-11-------------------------------------------------1--------------1-1111G112111113-111121111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHY:Sequence :ccEEEEEEcTTcHHHHHHHHHHHHHTGGGcEEEEEcccccTTcccTTccccccccTTcHH:Sec Str : ===========================================================:RP:SCP|2->157|2gyyA1|5e-37|39.6|149/150|c.2.1.3 :============================================================:BL:SWS|1->337|DHAS_AQUAE|e-105|56.7|337/340 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->115|PF01118|9e-18|43.6|110/120|Semialdhyde_dh 61: . . . * . .: 120 :DFSDVDICLMSAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFT:Sequence :HHHTccEEEEcccHHHHHHHHHHHHTTTcEEEEcccTTTTcTTEEEEcHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->157|2gyyA1|5e-37|39.6|149/150|c.2.1.3 :============================================================:BL:SWS|1->337|DHAS_AQUAE|e-105|56.7|337/340 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->115|PF01118|9e-18|43.6|110/120|Semialdhyde_dh 121: . . + . . .: 180 :KKNIIANPNCSTAQLVVALKPLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTN:Sequence :HTTEEEEccHHHHHHHHHHHHHHTTTcEEEEEEEEEEccTTTcHHHHHHHHHHHHHHHcc:Sec Str :===================================== :RP:SCP|2->157|2gyyA1|5e-37|39.6|149/150|c.2.1.3 : ====================================================:RP:SCP|129->319|1brmA2|2e-67|31.1|180/210|d.81.1.1 :============================================================:BL:SWS|1->337|DHAS_AQUAE|e-105|56.7|337/340 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|139->318|PF02774|2e-34|52.5|162/165|Semialdhyde_dhC 181: . * . . . .: 240 :SELVNKKFPKRIAFNVIPEIDVFMEDGYTKEEWKMMVETKKILDPAIKLSATCVRVPVFV:Sequence :HHHHHHHHHHHTTTccccccTTcccccccccccccHHHHHHHTTccccEEEEEEEccccc:Sec Str : ############:PROS|229->243|PS01103|ASD|PDOC00847| :============================================================:RP:SCP|129->319|1brmA2|2e-67|31.1|180/210|d.81.1.1 :============================================================:BL:SWS|1->337|DHAS_AQUAE|e-105|56.7|337/340 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|139->318|PF02774|2e-34|52.5|162/165|Semialdhyde_dhC 241: + . . . . *: 300 :GHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGYVTPYEAAGEDATYISRIRTD:Sequence :EEEEEEEEEEcccccHHHHHHHHHHTcccccccHHHHHHHccHHHHTTcccccEEEEEEc:Sec Str :### :PROS|229->243|PS01103|ASD|PDOC00847| :============================================================:RP:SCP|129->319|1brmA2|2e-67|31.1|180/210|d.81.1.1 :============================================================:BL:SWS|1->337|DHAS_AQUAE|e-105|56.7|337/340 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|139->318|PF02774|2e-34|52.5|162/165|Semialdhyde_dhC 301: . . . . + .: 360 :PTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAKKKAA :Sequence :TTcTTEEEEEEEEETTcccccHHHHHHHHHHHHHccc :Sec Str :=================== :RP:SCP|129->319|1brmA2|2e-67|31.1|180/210|d.81.1.1 :===================================== :BL:SWS|1->337|DHAS_AQUAE|e-105|56.7|337/340 :$$$$$$$$$$$$$$$$$$ :RP:PFM|139->318|PF02774|2e-34|52.5|162/165|Semialdhyde_dhC