[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE37891.1"

            "NADH/Ubiquinone/plastoquinone (complex I)"
            ""

OrgPattern 11-1----------1-3-112---21122422-----------11-1112322-1--1-2-2112-11 2222121222211121111-11--12111111222222221112-212311-11111---13111322232--------11133312111111---1--1-111-22331--------------1211212211224443422221332233233222222222232233311111111111111211---11122222222222222221221222132322111111111113333333333333322323----------------------------------------------------------------------11--1------------------1----3--1-2211--1112--11---222111222222111334324343322222222222-22222121211113342342224321122433434433211111111322-112322112111221111111111111112222112-1-2222211111121111221111111111122211122111322221121223321221111111123421221--111-222112-222123226222214-2111111111111111111111121222111-3-12-11------2------112-321--522211111111221112221211111-2222211221212122222111211121111111111111111111122221-211111111111111122221222231121----1----------222222211131222222214222232221111111113----22212-----22323223331111111-111111-------------------------------------1--------131 ---------------------------111---111-----------1------121-----2-1----------------------------1---11------1------11112-----1-11-1-12--11-----1--11--------1-1-------1-112----12-1----------1-4--2------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPIHHLPLLAPIALLAVAAVSFANTGLRPKRLPGLAEAAALLALAAALASAAGLIVSGTH:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|3->20|ihhlpllapiallavaav : XXXXXXXXXXXXXXXXXXXX :SEG|35->54|laeaaallalaaalasaagl 61: . . . * . .: 120 :VSPVLGLYGAGFSLRLDAVSAVMLLLVSFIGWVVVRYAGTYLDGEARQGPFTGWLCMTLA:Sequence : :Sec Str : XXX:SEG|118->128|tlaavlllvta : ======================================================:BL:SWS|67->349|NU5M_METSE|3e-33|28.4|282/600 121: . . + . . .: 180 :AVLLLVTAGNLVQLVLCWIATSVFLHRLLLFYPDRLPARRAARKKLVTARLGDVALIGSA:Sequence : :Sec Str :XXXXXXXX :SEG|118->128|tlaavlllvta : XXXXXX :SEG|158->163|arraar : X:SEG|180->186|aallaaa :============================================================:BL:SWS|67->349|NU5M_METSE|3e-33|28.4|282/600 181: . * . . . .: 240 :ALLAAAYGTADIGSILQAARLGEGGSLAVGAAGLLAFAAVLKSAQFPAHGWLTEVMETPT:Sequence : cccccccccccc:Sec Str :XXXXXX :SEG|180->186|aallaaa : XXXXXXXXXXXXXXXXXXXXX :SEG|201->221|lgeggslavgaagllafaavl : ===================:RP:SCP|222->297|1qd1A2|7e-06|10.8|65/140|d.58.34.1 :============================================================:BL:SWS|67->349|NU5M_METSE|3e-33|28.4|282/600 : $$$$$$$$$$$$$$$$$$$:RP:PFM|222->350|PF00361|5e-17|38.8|129/268|Oxidored_q1 241: + . . . . *: 300 :PVSALLHAGVINAGGFLLIRFADVMLLAPAVLAALVMIGGFTAVFGGLVMLTQPAVKTSL:Sequence :ccEEEEcHHHHTTTcTHHHHHH HHHHHHHcccccccccHHHHHHHHHHHHHHT:Sec Str : XXXXXXXXXXXXXX :SEG|264->277|vmllapavlaalvm :========================================================= :RP:SCP|222->297|1qd1A2|7e-06|10.8|65/140|d.58.34.1 :============================================================:BL:SWS|67->349|NU5M_METSE|3e-33|28.4|282/600 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|222->350|PF00361|5e-17|38.8|129/268|Oxidored_q1 301: . . . . + .: 360 :AWSTVAQMGFMILECGLALFPVALLHIVAHSLYKAHSFLASGGAVERVAAIRRPGPVAIP:Sequence :TcHHHHHHHHHHHHTTcccccHHHHHHHHHccccccccc :Sec Str :================================================= :BL:SWS|67->349|NU5M_METSE|3e-33|28.4|282/600 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|222->350|PF00361|5e-17|38.8|129/268|Oxidored_q1 361: . . . * . .: 420 :DAGAVGRAFLAALVIYILVGLGFGLTHKSPQVVALGAILIFGVAYMLAQGFADAAPKALT:Sequence : :Sec Str 421: . . + . . .: 480 :LRTAVYAVATSVGYFALQSSATLLTASVLPATPTPGPLEWALIVIALVSFGLIAIVQAMF:Sequence : :Sec Str 481: . * . . . .: 540 :PLWAYHPAAAGLRVHLSNGFYANAVFDRLVGGWATRNAS :Sequence : :Sec Str