[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE37963.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -1------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1------------------------1111--------11-----1-----------------1---1--1-------------1----------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNKDDRKAAITAYKERKPKAAIYAIRCTAADALWVGPTLNPDSVQNRIWFTLRFGNHPNR:Sequence : EEEEccccHHHHHHTccccTTTcccGGG:Sec Str 61: . . . * . .: 120 :DLQQAWTAHGADAFAIETLELFEPDADRYLRDNQLKDRAAHWRSKLDARPV :Sequence :cTTccTTccHHHHHHHHHHHTTGGGccEEE :Sec Str