[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38048.1"

            "glutamate--cysteine ligase"
            ""

OrgPattern -------------------------------------------------------------------- ----1---------11111-11--1111111-11111111-11-----------------11--111111-1111111-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------11-----------1-------------111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-----------------------------111111---------------------------------------------------------------------------------------------1-111111---------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111113221111--1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1118111113212-12--1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MARDQIDMTPLNSRDELVGWIEAGVKPPSEFRIGTEHEKTPFTLEGHHPVPYAGARGIGA:Sequence : cccccHHHHHHHHHHTcGGGGTTcEEEEEEEEEEEHHHHcGGGGTTcEEEEEE:Sec Str : ===================================:RP:SCP|26->455|1r8gA|5e-31|16.8|339/352|d.128.1.3 : ================================================:BL:SWS|13->456|GSH1_TOBAC|e-146|58.4|433/522 61: . . . * . .: 120 :LLEGMQLLLGWEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLDNVHQTHAELMAH:Sequence :EEEEEcTTTcccccccccGGGccTTcGTcccTTTcccEEEcccTTEEEEEccccccHHHH:Sec Str :============================================================:RP:SCP|26->455|1r8gA|5e-31|16.8|339/352|d.128.1.3 :============================================================:BL:SWS|13->456|GSH1_TOBAC|e-146|58.4|433/522 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->358|PF04107|4e-62|51.3|265/285|GCS2 121: . . + . . .: 180 :LAQVREVATPLGIGFLGLGMTPSWSREDIPVMPKGRYKIMTNYMPKVGSYGLDMMYRTCT:Sequence :HHHHHTccTTcEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccGGGGGGccE:Sec Str :============================================================:RP:SCP|26->455|1r8gA|5e-31|16.8|339/352|d.128.1.3 :============================================================:BL:SWS|13->456|GSH1_TOBAC|e-146|58.4|433/522 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->358|PF04107|4e-62|51.3|265/285|GCS2 181: . * . . . .: 240 :VQTNLDFSSEADMVKKLRVSVALQPVATALFANSPFTEGKPNGFLSFRSEIWRDTDNARS:Sequence :EEEEEEccHHHHHHHHHHHHHHHTTHHHHHHccccGccccccEEcTTccEEcTTcccGGG:Sec Str :============================================================:RP:SCP|26->455|1r8gA|5e-31|16.8|339/352|d.128.1.3 :============================================================:BL:SWS|13->456|GSH1_TOBAC|e-146|58.4|433/522 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->358|PF04107|4e-62|51.3|265/285|GCS2 241: + . . . . *: 300 :GMIPWAFEDGMGFERWVDYALDVPMYFVKRGDHYIDVSGSSFRDFFDGKNEKLPGERPTL:Sequence :cTTcccccGGGccccHHHHHHHHHHHHTcccHHHHHHccEETTEEccccccccccccGGG:Sec Str :============================================================:RP:SCP|26->455|1r8gA|5e-31|16.8|339/352|d.128.1.3 :============================================================:BL:SWS|13->456|GSH1_TOBAC|e-146|58.4|433/522 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->358|PF04107|4e-62|51.3|265/285|GCS2 301: . . . . + .: 360 :SDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDTSLDAAWEIVKGW:Sequence :ccccEEEEccccccHHHHEEEEEEEEccTTcTTcccccHHHHHHHHHHHHHHHHcccccc:Sec Str :============================================================:RP:SCP|26->455|1r8gA|5e-31|16.8|339/352|d.128.1.3 :============================================================:BL:SWS|13->456|GSH1_TOBAC|e-146|58.4|433/522 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|69->358|PF04107|4e-62|51.3|265/285|GCS2 361: . . . * . .: 420 :DASERQALRDDVPRLGFKARIGNRFLFEIARECLVLAHAGLRRRGRIDGFGHDETRHLAA:Sequence :cHHHHHHHHHHHHHHHHHTTcTcEEccTTccccEEHHHHHHHHHHHHHHHHHcccHHHHH:Sec Str :============================================================:RP:SCP|26->455|1r8gA|5e-31|16.8|339/352|d.128.1.3 :============================================================:BL:SWS|13->456|GSH1_TOBAC|e-146|58.4|433/522 421: . . + . . .: 480 :LDQILDAGRTPAEEMLEKFDGAWRGSVEPAYDEYAF :Sequence :HHHHHHHGGcHHHHHHHHHHHHHHHHHHTHHHHTcc :Sec Str :=================================== :RP:SCP|26->455|1r8gA|5e-31|16.8|339/352|d.128.1.3 :==================================== :BL:SWS|13->456|GSH1_TOBAC|e-146|58.4|433/522