[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38049.1"

            "N/apple PAN precursor protein"
            ""

OrgPattern -----------------------------------------------1-------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRRGGSVRAWLFVLALAAAALAPRVAQAQANFDRPGADYLRAKVSSNDPADCALMCERDR:Sequence : HHHHHHHcc:Sec Str : XXXXXXXXXXXXXXXXXXXXXXX :SEG|8->30|rawlfvlalaaaalaprvaqaqa 61: . . . * . .: 120 :RCRSWTFAYPQAPEDGAFCWLKSSVPQRSPSNCCVSGVRGAGVLEPRNGSIEASIDRFGG:Sequence :cccEEEEEcccTTcccTEEEEEccGGGcccEEEEEEEEEEcccccccccccEEEEEEEcE:Sec Str : ================================:BL:SWS|89->167|YL719_MIMIV|1e-05|31.9|69/343 121: . . + . . .: 180 :DYRNFELKANEADDACKAACEQDNKCRAWTYARPGYVGRNARCFLKNQIKPPQRKPGFFS:Sequence :EEEEEEcccHH HHHHHHHTcccccEEEEEccccccTTE EEEEE :Sec Str :=============================================== :BL:SWS|89->167|YL719_MIMIV|1e-05|31.9|69/343 181: . * . . . .: 240 :GVVR :Sequence : :Sec Str