[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38106.1"

            "diguanylate cyclase"
            ""

OrgPattern -------------------------------------------------------------------- F9128---111---13211-18----11111-91111954975KX-------524-----852-7194432---------41669H45-------------------------------------11111111161BBB8A11163jMOBHH123DC---3--5F7-AAF3------------K6B54981482333333542353445-222223354449-BD333333A9-1111111111111111111--2--------33---1--1--------------------------------------------------38669444444433437443454428--54469DCEB774A7522332--A285662-----15OLO53EPLGKP3477367567H-PNILLAMJ8R5-CLLKNOIMOTA7OC5A8262BC89654--------9991-d9O11111111111111111111111-11111-42E929A841GCDEEED777699LS888828GQMDJEL-2KLGRGWGJP11b88OMQSGROUH-------36BIfm4HPHIGJO9gPHFI1IGKWHNFUN6555A664C543----------------OAEI632USFOYReDZMZfZbbYWdRbaaSWUWTRlg---8RBa------AEFA2H7BBBABAAACA-ABACB77ABAB9AABBAABADABD--16467666666566676A6556468--D23333333333---M-----ACBAC8eDe---------------6566625-1-EUNNMMRTVUWTTRSNQQU-----1---PJMJKOONNNJSNaaKKIIGIGABB1111--X26655CC-1111111411-------------------------8723466666-1- -----------------------------------------------------------------------------------------------1--------------------------------------------------------------1----4---------42----------1--6-----6---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRKEIGRRRRMSARLLIASSVITVLGFSAVCGSIMLDMRGNAQELARQTQENLASTISAD:Sequence : GTHHHHHHHHHHHHHHHHHHHHH:Sec Str : ====================:RP:SCP|41->193|2p7jA2|6e-11|11.1|153/172|d.110.6.2 61: . . . * . .: 120 :INRNIEAYDLSLRSVVSNLALPQLAHVDETLRRLILFDHASIARHFGSIQVFDAQGNLTI:Sequence :HHHHHHHHHHHHHHHHHHHHHccHHHHcHHHHHHHHccHHHHHHcccEEEEETTTccEEc:Sec Str :============================================================:RP:SCP|41->193|2p7jA2|6e-11|11.1|153/172|d.110.6.2 121: . . + . . .: 180 :DSATLTPEKLNRGDEPFVSAHRDDPTVGLYISRPMQHRGTFAIVLSRRISGTDGRFLGVV:Sequence :cTTccccccccGGGcHHHHHHHHHTccEEcccEEcTTTccEEEEEEEEEcTTTccEEEEE:Sec Str :============================================================:RP:SCP|41->193|2p7jA2|6e-11|11.1|153/172|d.110.6.2 181: . * . . . .: 240 :AGSIRFSYFKQVFSRLRLEPDDTIGVVARDGTLVMRTPFRPDVIGTNVMGAPGVRQVFSQ:Sequence :EEEEcHHHHHHHHTccccTTcEEEEEEETTccEEEcccGcGGGTTccHHHHccccccccc:Sec Str :============= :RP:SCP|41->193|2p7jA2|6e-11|11.1|153/172|d.110.6.2 241: + . . . . *: 300 :RRGWYSGEGIIDQIPRMMVWADGTRPLVVIVGKSWSDVFRMWRHEAIRISLILLGLAIIV:Sequence :EEEEETTEcccccccccEEEEEcccccccccEEEEEEETTEEEEEEEcccccGGGccccc:Sec Str : XXXXXXXXXXXXXXX:SEG|286->301|airislillglaiiva 301: . . . . + .: 360 :AGFTVFFIREIDRRAEAERRLEELATTDSLTGLINRRKFDTLIEREWRRALRMNTPIALL:Sequence :cccccccccccccTTTTccHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHccccccTT:Sec Str :X :SEG|286->301|airislillglaiiva : XXXXXXXXXXXXXXXXXX :SEG|308->325|ireidrraeaerrleela : ===============================:RP:SCP|330->486|1w25A3|2e-29|34.6|156/162|d.58.29.2 : =================================:BL:SWS|328->453|PHY2_SYNY3|7e-27|47.6|126/1276 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->480|PF00990|2e-26|46.4|151/160|GGDEF 361: . . . * . .: 420 :IIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATA:Sequence :ccTTcccccGGGEEEEEcTTccEEEEEccHHEEEEEccccTTccEEEccccccccTTTcc:Sec Str :============================================================:RP:SCP|330->486|1w25A3|2e-29|34.6|156/162|d.58.29.2 :============================================================:BL:SWS|328->453|PHY2_SYNY3|7e-27|47.6|126/1276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->480|PF00990|2e-26|46.4|151/160|GGDEF 421: . . + . . .: 480 :AQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQHWPVLFEAADKALYAAKDLGRNC:Sequence :ccccEEEEccccEEcEEcGGGTcTTcccccEEccHHHHHHHHHHHHHHHHHHHHTTTccc:Sec Str : XXXXXXXXXXXX :SEG|465->476|aadkalyaakdl :============================================================:RP:SCP|330->486|1w25A3|2e-29|34.6|156/162|d.58.29.2 :================================= :BL:SWS|328->453|PHY2_SYNY3|7e-27|47.6|126/1276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->480|PF00990|2e-26|46.4|151/160|GGDEF 481: . * . . . .: 540 :CVVAASRHDLTLAA :Sequence :EEEEEc :Sec Str :====== :RP:SCP|330->486|1w25A3|2e-29|34.6|156/162|d.58.29.2