[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38119.1"

            "benzoyl-CoA oxygenase, component B"
            ""

OrgPattern -------11--1112----------------------------------------------------- ----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112---1-111------------------------------------------1-------1-------------1-----------------------------------------1-------------11--------22121-----1----111211-------------------11------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTANSTTRDPTGSHAMNIMNVDYSTKIPNNVDLASDRQVLKALEGWHPGYIDWWNDMGPE:Sequence : cccHHHHHHHHTccccccccccHcccHHHH:Sec Str : ========================================:BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100 61: . . . * . .: 120 :GFQQSLVYLRTAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRTIPFGEHYGEPAWQEV:Sequence :HccHHHHccTTccGGGGGGccccccccHHHHccHHHHHHHHHHHHHHHHHTTTccHHHHc:Sec Str : ==============:RP:SCP|107->284|2itbA1|8e-16|12.9|170/199|a.25.1.7 :============================================================:BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100 : $:RP:PFM|120->284|PF05138|1e-14|34.6|156/260|PaaA_PaaC 121: . . + . . .: 180 :PGEYRAMLRRLIVIQGDTEPASVEQQRHLGKTAPSLYDMRNLFQVNVEEGRHLWAMVYLL:Sequence :cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHTHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|107->284|2itbA1|8e-16|12.9|170/199|a.25.1.7 :============================================================:BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|120->284|PF05138|1e-14|34.6|156/260|PaaA_PaaC 181: . * . . . .: 240 :QKYFGRDGREEADDLLRRRSGDADSPRMLGAFNEATPDWLSFFMFTYFTDRDGKMQLHSL:Sequence :HTTTTTcGGGGHHHHGGGcccHHHHHHHHHHHHTTcccHHHHHHHcccccTTTTHHHHHT:Sec Str :============================================================:RP:SCP|107->284|2itbA1|8e-16|12.9|170/199|a.25.1.7 :============================================================:BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|120->284|PF05138|1e-14|34.6|156/260|PaaA_PaaC 241: + . . . . *: 300 :AQSGFDPLSRTCRFMLTEEAHHMFVGETGISRIVQRTCEAMRDAGISDPTDIAKVRALGV:Sequence :HHTTcHHHHHHHHHHHHHHHHHGTHHHHHHHHHHHHccHHHHHH :Sec Str :============================================ :RP:SCP|107->284|2itbA1|8e-16|12.9|170/199|a.25.1.7 :============================================================:BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|120->284|PF05138|1e-14|34.6|156/260|PaaA_PaaC 301: . . . . + .: 360 :IDLPTIQKKLNLHYTLSLDLFGSEVSTNAANAFNAGIKGRYHETQIDDDHRLANDTYPVL:Sequence : :Sec Str :============================================================:BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100 361: . . . * . .: 420 :KFVNGEIKRVDEPALTALNMRLRDDYSQDCVKGLLRWNKVITTAGYDFQLALPHVAFHRA:Sequence : :Sec Str :============================================================:BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100 421: . . + . . .: 480 :IGEFKGVHATPEGLLIDGATWARRKDDWLPSTDDGDFIASLMQPVSDPGAYAPWIAAPKV:Sequence : :Sec Str :============================================================:BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100 481: . * . . . .: 540 :GIDNKPGDFEYVKIET :Sequence : :Sec Str :============= :BL:SWS|21->493|BOXB_AZOEV|e-168|58.5|470/100