[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38168.1"

            "electron transfer flavoprotein beta-subunit"
ETFB_BRAJA  "RecName: Full=Electron transfer flavoprotein subunit beta;         Short=Beta-ETF;AltName: Full=Electron transfer flavoprotein small subunit;         Short=ETFSS;"

OrgPattern 22----2222222222-11311211111-111-----------------------------2322--- 12321-1111111111111-11111111111111111112111111-11---111-12--112-1111121---------11------11111122---111111111-1---------------1111111112111122---12-------11-----------1----------------11111--11211111111111111111111111111131111------21----------------------1--------------------------------------------------------------------532444444443431422422214-1-1-12-663363-141--1--2-12-11111111132222111222221111111111111121131112113112334335232311111111111112222222212211322-----------------------------1121112311211122211111113611111134511121112161222231212111-112111111111---14115421----------7471926--11211114-------------------------1111-1111121-1111111311112132121-----1-------1---1-----1-111-------111-1--1---------------111-11111-1-1--1-------------------------1111111111-1113---------------11111111114111111111111111112-------------1-----11-1111111111111111--11111111----------1-------------------------11111121111-- ----111-211-111-11111111111111111111111111111111111111-1111111111111-11111111111111111-1-12111111111111112-1212111121-1--11111131282-112-11-11111-11111--1--1111111111121121121111-----111112-111121111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVV:Sequence :cEEEEEccEEEcTTccccccTTccccccTTccEEEcHHHHHHHHHHHHHHHTTcccEEEE:Sec Str :============================================================:RP:SCP|1->242|1efpB|1e-62|73.6|242/246|c.26.2.3 :============================================================:BL:SWS|1->249|ETFB_BRAJA|e-125|91.6|249/249 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->175|PF01012|4e-18|48.9|139/157|ETF 61: . . . * . .: 120 :VSIGPAQASETLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAI:Sequence :EEEEcTTHHHHHHHHHHHTccEEEEEEccHTccHHHHHHHHHHHHHHTTccEEEEEcccT:Sec Str :============================================================:RP:SCP|1->242|1efpB|1e-62|73.6|242/246|c.26.2.3 :============================================================:BL:SWS|1->249|ETFB_BRAJA|e-125|91.6|249/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|32->175|PF01012|4e-18|48.9|139/157|ETF 121: . . + . . .: 180 :DDDSNQTGQMLAALLGWAQATFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRL:Sequence :TTccccHHHHHHHHHTccEEEEEEEEEEcccEEEEEEEETTEEEEEEEEccEEEEEcTTc:Sec Str : ##################### :PROS|155->175|PS01065|ETF_BETA|PDOC00816| :============================================================:RP:SCP|1->242|1efpB|1e-62|73.6|242/246|c.26.2.3 :============================================================:BL:SWS|1->249|ETFB_BRAJA|e-125|91.6|249/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|32->175|PF01012|4e-18|48.9|139/157|ETF 181: . * . . . .: 240 :NEPRYASLPNIMKAKKKPIAEKTADQYGVDLAPRLEVLKTVEPSGRKAGVKVKDVAELVS:Sequence :cccccccHHHHHHHTTccEEEEcGGGGTccccccccccccccccccccccccccHHHHHH:Sec Str :============================================================:RP:SCP|1->242|1efpB|1e-62|73.6|242/246|c.26.2.3 :============================================================:BL:SWS|1->249|ETFB_BRAJA|e-125|91.6|249/249 241: + . . . . *: 300 :KLKNEAGVI :Sequence :HHHHTTccT :Sec Str :== :RP:SCP|1->242|1efpB|1e-62|73.6|242/246|c.26.2.3 :========= :BL:SWS|1->249|ETFB_BRAJA|e-125|91.6|249/249