[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE38168.1 rpal2 ABE38168.1 "electron transfer flavoprotein beta-subunit"
MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVV
VSIGPAQASETLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAI
DDDSNQTGQMLAALLGWAQATFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRL
NEPRYASLPNIMKAKKKPIAEKTADQYGVDLAPRLEVLKTVEPSGRKAGVKVKDVAELVS
KLKNEAGVI
//