[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38181.1"

            "ABC transporter related"
            ""

OrgPattern TTH8MKGCSRSPSMTJjGLLIMLUpKNfkReSHADCABGFHEBQZNUhLR*yd8RWOSVIRIHBS169 QWlL*YWWddfOTLUSTLL-LdAAU*MMMMMLlhhhp***P*W*o*pbmibOv*rLSbABqumg*s****cZXVVyYVTLxbgBBBACNNMI5KCFG--CDQGEFYIRMN6555555AA99999FTPKPUINTSVQhnoxxJJJ*VkcflUTjZaQQMGJDJFabWh**xQDLGGFFFNDFDEWUbPOnf9Qat********w**********wx***fku**ehqnplom**WfggggdceefffedRYVSUsZXYvuWNTRYnmNOvxZTNUgbYZYkhlniiprrqlqmmhkmrkomXXXWVXXXaXXWVwjhbacljmde*q*********c*ef***TaaY*ijmi*YgQJ**mjXUajQYeYfdMSVXOaVSSKKMKKKYT***UTi****************-jj*gc*l***SB**************HKI**********QPQQQQQQnWaGPcV*444555554445559A4576475587595JDDDDD***********ztrto*****x*yc*******xBKtslykjjn*w****YmmPQILhUGIGHIHGQQNahgbx*PcVpjWhscamIbYXTVbhRSWWXYouVzHJHPFIIIKFFABBBBBBBBDPFDGKJhglLrRXHQHtQSUWSLSaSPPRSRWXTYZ5-CLRPL2-1111*t**U*puzzyv*z*sv-yuuvxwzvuxz*wstttsr*****ggdllhkklkkklkklkkl*okmoopsQ4x***********33JFDFCDDMNPNMG*i*TTSTRQIKKKINHJWMNOMNDRGLQkZvxuvw***w**swb***EDCABCCBDIblkvkllllz*vzxPPMILJIKMMCBBB54JSNNIIIK98787888*AVC9A8A-6AB9BBDIHF6CDCD8889QdoQQk*kmjDbM 1111QMC-TE58ENJB8B8AFJFKCJBCB7868GDE7D89AAB788A9CFECLHAAE8ABAA62512212324642212345534534-9C485467666636EA617GRPFKKVNREA99DLHfe6Z8**Y2ZJXEAD8WBETK8H87CQA8*FNKHeDV*BaEO7eRZ*LTMC8796*4876BbLRt8ePCAdQYVC -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVRFENVGLRYGLGPEILRDLNFAIPAHSFQFLTGPSGAGKTSLLRLLFLSLRPTRGLVN:Sequence : XXXXXXXXXXX :SEG|43->53|sllrllflslr :============================================================:RP:SCP|1->213|1sgwA|3e-33|15.8|196/200|c.37.1.12 :============================================================:BL:SWS|1->216|FTSE_SHIFL|8e-44|42.1|216/222 61: . . . * . .: 120 :LFGNDVSLLTKDEVSALRQRIGIVLQDFRLLDHMTTYENVALPFRVSGRDESSYRKEVID:Sequence :============================================================:RP:SCP|1->213|1sgwA|3e-33|15.8|196/200|c.37.1.12 :============================================================:BL:SWS|1->216|FTSE_SHIFL|8e-44|42.1|216/222 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|80->165|PF00005|1e-13|43.0|86/123|ABC_tran 121: . . + . . .: 180 :LLKWVGLGERMDALPPVLSGGEKQRAAIARAVIGRPQLLLADEPTGNVDPTLGRRLLRLF:Sequence : ############### :PROS|138->152|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|1->213|1sgwA|3e-33|15.8|196/200|c.37.1.12 :============================================================:BL:SWS|1->216|FTSE_SHIFL|8e-44|42.1|216/222 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|80->165|PF00005|1e-13|43.0|86/123|ABC_tran 181: . * . . . .: 240 :VELNKSGTAVVIATHDINLMDQYEARRMVLHQGRLHIYE :Sequence :================================= :RP:SCP|1->213|1sgwA|3e-33|15.8|196/200|c.37.1.12 :==================================== :BL:SWS|1->216|FTSE_SHIFL|8e-44|42.1|216/222