[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38253.1"

            "monooxygenase, FAD-binding"
            ""

OrgPattern -------------------------------------------------------------------- --1181-1222---553----2--66------754533C9-527-11-----443111--471-52B8533-----------1------------------------1----------------------------------------1----------------------------------1-1-------111111-12-11212-1111-1111----111------1---------------------------------------------------------------------------------------------------------------------------------------------1--1---------16851--11112------------11211512132-3--421-252-12411-232-----1111111111----1-----------------------------------8--211133455342222244362222226482731--11112---213-43--1----------------1111---------------------------46-----------------------------11---2------1-111-----1----1----------------------111-1---11-11111-11111-111-11-121-111-1----11111--1----------1-------------------1---1-1111-11------------------1-------------112----1-1-1--------------11111-----11----------------------------------------------------------------------- ----11---------719498B6D7EC4422112122------332633869E932543443--1-------------------1----4Q714E3----212212--5-------------------------------------------------1--------------1------1111111-2911------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLHQEHFHFGYRRHPDQDRDNDPARHPVVVVGAGPVGLSLAIDLAQRGENVVLLDDADR:Sequence : HHHHHHHHTTccEEEEEEcccc:Sec Str : XXXXXXXXXXX :SEG|28->38|pvvvvgagpvg : ======================:BL:SWS|39->375|MHPA_ECO8A|2e-32|29.9|328/554 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->359|PF01494|8e-36|36.7|311/338|FAD_binding_3 61: . . . * . .: 120 :IGEGSRAICFSKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMP:Sequence :ccccccEEEEcHHHHHHHHHTTcHHHHHHHcEEEcEEEEEcTTccEEEEEEcGGGGTccc:Sec Str :============================================================:BL:SWS|39->375|MHPA_ECO8A|2e-32|29.9|328/554 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->359|PF01494|8e-36|36.7|311/338|FAD_binding_3 121: . . + . . .: 180 :AFINLQQYYAEAYLVERVQQLPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYV:Sequence :cEEEEEHHHHHHHHHHHHHHHcTTcEEEcEEEEEEEEETTEEEEEEEETTcEEEEEEcEE:Sec Str : ==================================:RP:SCP|147->355|3c96A1|3e-22|13.9|201/269|c.3.1.2 :============================================================:BL:SWS|39->375|MHPA_ECO8A|2e-32|29.9|328/554 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->359|PF01494|8e-36|36.7|311/338|FAD_binding_3 181: . * . . . .: 240 :VACDGARSALRGMVGAEFAGEVFEDQFLIADVRMNAEFPTERWFWFDPPFHSGQSALLHR:Sequence :EEcccTTcHHHHHHcTTccccEEEEEEEEEEEEEEcccTTccEEEEEEcTTccEEEEEEc:Sec Str :============================================================:RP:SCP|147->355|3c96A1|3e-22|13.9|201/269|c.3.1.2 :============================================================:BL:SWS|39->375|MHPA_ECO8A|2e-32|29.9|328/554 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->359|PF01494|8e-36|36.7|311/338|FAD_binding_3 241: + . . . . *: 300 :QPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDFSFEWISIYKFQCRRMQRFLH:Sequence :cHHHHTTTcEEEEcccHHHHHHHHTTcccTTccHHHHHHTccEEEEEEEEEccccccccc:Sec Str :============================================================:RP:SCP|147->355|3c96A1|3e-22|13.9|201/269|c.3.1.2 :============================================================:BL:SWS|39->375|MHPA_ECO8A|2e-32|29.9|328/554 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->359|PF01494|8e-36|36.7|311/338|FAD_binding_3 301: . . . . + .: 360 :ERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDSYEIERSQAAD:Sequence :TTEEEcTHHHHcccccTTcTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHH:Sec Str :======================================================= :RP:SCP|147->355|3c96A1|3e-22|13.9|201/269|c.3.1.2 :============================================================:BL:SWS|39->375|MHPA_ECO8A|2e-32|29.9|328/554 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|39->359|PF01494|8e-36|36.7|311/338|FAD_binding_3 361: . . . * . .: 420 :DNIRHSTRSTDFIAPHSKQERRLRDVALALARDVEFAKRMVNAGRLSTPTAYDTPLSTPD:Sequence :HHHHHHHHHHHHHcGGGGGTccccccHHHHHTccccccTTccccc ccccccccTT ccc:Sec Str : XXXXXXXXXXXXXX :SEG|381->394|rrlrdvalalardv :=============== :BL:SWS|39->375|MHPA_ECO8A|2e-32|29.9|328/554 421: . . + . . .: 480 :ADAWSAGPKPGAALLDAPLQAADGGPVFLTDAFKAAGCGFVLLEIANGAAAPAPQGVRSL:Sequence :ccTTccccccEEEETTEE EEGGGGc cccEEEEEcTTcHHEETTTTEEcc:Sec Str : XXXXXXXXXXXXXXXX :SEG|430->445|pgaalldaplqaadgg : ==================================:RP:SCP|447->522|1fohA3|7e-05|10.7|75/201|c.47.1.10 481: . * . . . .: 540 :RIGKDAPLRDEEGLFTKRYDATPGAAYLLRPDGYVAARFRHPTQAALDAALARASGRAGR:Sequence :ccEEEcccccTTccHHHHTcTTTcEEEEEcTTccEEEEEcTTc :Sec Str : XXXXXXXXXXXXXXX :SEG|525->539|aaldaalarasgrag :========================================== :RP:SCP|447->522|1fohA3|7e-05|10.7|75/201|c.47.1.10