[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38261.1"

            "xanthine dehydrogenase, molybdenum binding subunit apoprotein"
            ""

OrgPattern 223-1-788888988A--21111-2---1--------------------------------1------ 11523---------1--11-12--5711111433331369131311---11-2-21------9-149244--------1---4--------------------1-2-1----------------------------33333----A-1-111---------------1-2--------------23-------1-----1---------12---1----21-----------1--------------------1----------------------------------------------------------------------64-24444344434-5------31-21-112-312332-3-4-----------111-------CAC312566851111-11-111-75A54A79672-52241183216943-1-7613333547111111118111-321--------------------------------3--521224332231----2266------11C8792--4421-311523152-2-----------------21-1-3-4111121111--1111-113----11-3-------------------------222--1--1-1---11111-2---------------1---------1--2--3332322232-3333212323323332331------------------------21--1112-----------------------------12----------------1111111-111122222132122321323-------------3----------11-2-22----------2-------------------------------------------2322-----12- ------------11-1122111-1111--23-21111111-1111111---11-------1------------1------------------1---------1----2--422221B122--4116141272-314--1-11131-12119-18-522313L-56133255A-33----A----12362252--1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGIEGIGASVVRKEDRRFITGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAM:Sequence :HHHTcTTcccccTTHHHHHTTccccGGGccccTcEEEEEEEcccccEEEEEEEcTTGGGc:Sec Str :============================================================:RP:SCP|1->127|1ffuB1|2e-33|45.7|116/140|d.41.1.1 : ==========================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|20->127|PF01315|8e-20|52.6|97/110|Ald_Xan_dh_C 61: . . . * . .: 120 :PGVVDVLTGQQIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAE:Sequence :TTEEEEEcGGGcccccEEcTTccEEccEEcccccTTccEEcccccEEccTTcEEEEEEEc:Sec Str :============================================================:RP:SCP|1->127|1ffuB1|2e-33|45.7|116/140|d.41.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|20->127|PF01315|8e-20|52.6|97/110|Ald_Xan_dh_C 121: . . + . . .: 180 :SKNLARDAAEAVVVEYEELPAVADIKAAIAPGAAQLHPEAPGNIVYDWEIGDQKAVDEAF:Sequence :cHHHHHHHHTTcEEEEEEccccccHHHHTTTTcccHHHTccccccEEEEEcccccHHHHT:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|128->154|aaeavvveyeelpavadikaaiapgaa :======= :RP:SCP|1->127|1ffuB1|2e-33|45.7|116/140|d.41.1.1 : =============:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$ :RP:PFM|20->127|PF01315|8e-20|52.6|97/110|Ald_Xan_dh_C : $$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 181: . * . . . .: 240 :GKAANVVSFELTNNRLVPNAMEPRAAIADYNSAEEHFTLYTTSQNPHVARLVLSAFYNIA:Sequence :TTccEEEEEEEEEcccccccccccEEEEEEcccTTcEEEEEccccHHHHHHHHHHHHTcc:Sec Str :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 241: + . . . . *: 300 :PEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAVKWTGDRSEAFLTDAHGRDHV:Sequence :cGGGEEEEEccccccTTTTcTTHHHHHHHHHHHHHHcccEEEEccHHHHHHHccccccEE:Sec Str : ############################## :PROS|252->281|PS00107|PROTEIN_KINASE_ATP|PDOC00100| :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 301: . . . . + .: 360 :SKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNIPAIYAEVIGV:Sequence :EEEEEEEcTTccEEEEEEEEEEEEEcccTTHHHHHHHHHHHTTTTTTcccccEEEEEEEE:Sec Str :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 361: . . . * . .: 420 :YTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD:Sequence :EcccccccccTTTTHHHHHHHHHHHHHHHHHHTTccHHHHHHHHcccTTccccTTccccc:Sec Str :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 421: . . + . . .: 480 :IGDFGASLDAALKAADYSGFAARKAKAKAEGKLRGLGFSCYIEACGIAPSKAVGSLGAGV:Sequence :cccHHHHHHHHHHHTTHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEcccEEEEEEccGG:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|439->457|gfaarkakakaegklrglg :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 481: . * . . . .: 540 :GLWESAEVRVNPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQF:Sequence :GcEEEEEEEEcTTccEEEEEccccccccHHHHHHHHHHHHHTccGGGEEcccEETTTccc:Sec Str :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 541: + . . . . *: 600 :GMGTYGSRSAAVGMSAIFKAMEKVEAKAKKIAAHQLEASEGDIVIENGEFKVTGTDKSIA:Sequence :cccccTTTHHHHHHHHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHTTcccEEEEEE:Sec Str : XXXXXXXXXXXXXXX :SEG|559->573|kamekveakakkiaa : ############:PROS|589->620|PS00969|ANTENNA_COMP_BETA|PDOC00748| :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 601: . . . . + .: 660 :LPMVALAAYTAHNLPDGMEPGLKESAFYDPTNFTFPAGAYICELEVDPGTGKTSFVNFVA:Sequence :EHHcEEEEEEcccccccTTTTccccccEEcccEEEEEEEEEEEEEEETTTccEEEEEEEE:Sec Str :#################### :PROS|589->620|PS00969|ANTENNA_COMP_BETA|PDOC00748| :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 661: . . . * . .: 720 :VDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQLVTASFMDYAMPRADDVPSF:Sequence :EEEccccccHHHHHHHHHHHHHHHHHHHHTccccccTTcccccccTTTcccccGGGcccE:Sec Str :============================================================:RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :============================================================:BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|176->716|PF02738|3e-92|43.4|500/519|Ald_Xan_dh_C2 721: . . + . . .: 780 :KVSHTETLCPGNPLGVKGCGEAGAIGASAAVINAITDAIGHNRLEMPATPDRVWHAIHGN:Sequence :EEEEcccccTTcGGGccccccGGGGGGHHHHHHHHHHHHHHHcccccccHHHHHHHcccH:Sec Str :========================================================== :RP:SCP|168->778|1t3qB2|e-168|36.0|605/621|d.133.1.1 :====================================================== :BL:SWS|3->774|DCML_OLICO|e-128|39.5|749/809 781: . * . . . .: 840 :A :Sequence : :Sec Str