[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE38261.1 rpal2 ABE38261.1 "xanthine dehydrogenase, molybdenum binding subunit apoprotein"
MGIEGIGASVVRKEDRRFITGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAM
PGVVDVLTGQQIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAE
SKNLARDAAEAVVVEYEELPAVADIKAAIAPGAAQLHPEAPGNIVYDWEIGDQKAVDEAF
GKAANVVSFELTNNRLVPNAMEPRAAIADYNSAEEHFTLYTTSQNPHVARLVLSAFYNIA
PEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAVKWTGDRSEAFLTDAHGRDHV
SKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNIPAIYAEVIGV
YTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD
IGDFGASLDAALKAADYSGFAARKAKAKAEGKLRGLGFSCYIEACGIAPSKAVGSLGAGV
GLWESAEVRVNPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQF
GMGTYGSRSAAVGMSAIFKAMEKVEAKAKKIAAHQLEASEGDIVIENGEFKVTGTDKSIA
LPMVALAAYTAHNLPDGMEPGLKESAFYDPTNFTFPAGAYICELEVDPGTGKTSFVNFVA
VDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQLVTASFMDYAMPRADDVPSF
KVSHTETLCPGNPLGVKGCGEAGAIGASAAVINAITDAIGHNRLEMPATPDRVWHAIHGN
A
//