[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38351.1"

            "glycoside hydrolase, family 5"
            ""

OrgPattern ------------------------------------------------------1-1----------- ----2----------------1----------1-------1-------1211---------1--2-----1-------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------2-------1-4--------------------1-------------------------11-------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ -----1---------1--------------------------------11-111111-11-1---------------------------------------------------------------------------------------------------------------------------1--------1211- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDAAVPSHVADPPAIVRDAGDLRPAGRGGYLLPNGYLSTSGSQIVDASGRPVRIASIGWN:Sequence : HHcccEEETTEEEcTTccccccEEEEEc:Sec Str : ===:RP:SCP|58->402|1gzjA|5e-09|17.6|267/304|c.1.8.3 : =========================:BL:SWS|36->418|GUN1_ACIC1|1e-40|35.3|323/562 61: . . . * . .: 120 :GTEGPLGAAPSGIWRVSYKTVLDSIVAAGFNAVRIPWTDIGLNAPLNGYSDRLGWINITL:Sequence :cHTccTTcTHHHGGGccHHHHHHHHHHHcccEEEEEEEGGGTcccccTEccTTcTTTHGG:Sec Str :============================================================:RP:SCP|58->402|1gzjA|5e-09|17.6|267/304|c.1.8.3 :============================================================:BL:SWS|36->418|GUN1_ACIC1|1e-40|35.3|323/562 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|85->270|PF00150|3e-10|37.9|140/273|Cellulase 121: . . + . . .: 180 :NPELLASSTPNSQGRYQYVTTLVAFQRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFD:Sequence :cTTHHHHTTTEEEcccccEccHHHHHHHHHHHHHHTcEEEEEEEcTTccHHHHHHHHEEc:Sec Str :============================================================:RP:SCP|58->402|1gzjA|5e-09|17.6|267/304|c.1.8.3 :============================================================:BL:SWS|36->418|GUN1_ACIC1|1e-40|35.3|323/562 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|85->270|PF00150|3e-10|37.9|140/273|Cellulase 181: . * . . . .: 240 :LGPGTDNTDGIVPGRVTAETFKQNWLLVARTFANNPTVIGYDLHNEPNGDRGHITWGGGG:Sequence :cccccGGGGcTTTcHHHHHHHHHHHHHHHHHHTTcTTEEEEEcccccccccTTccTTccc:Sec Str : ########## :PROS|219->228|PS00659|GLYCOSYL_HYDROL_F5|PDOC00565| : ######### :PROS|230->238|PS01070|NUCLEASE_NON_SPEC|PDOC00821| :============================================================:RP:SCP|58->402|1gzjA|5e-09|17.6|267/304|c.1.8.3 :============================================================:BL:SWS|36->418|GUN1_ACIC1|1e-40|35.3|323/562 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|85->270|PF00150|3e-10|37.9|140/273|Cellulase 241: + . . . . *: 300 :PTDIKAMCEDVGSAIQDVSPGVLIICEGPETYKPPPASSGMDPRHAAPAGNLTAAGANPV:Sequence :cTTHHHHHHHHHHHHHHHcccccEEEccHHHHHTcHHHHHTccccccEEEEEEEcccHHH:Sec Str : XXXXXXXXXXXXXX :SEG|286->299|aapagnltaaganp :============================================================:RP:SCP|58->402|1gzjA|5e-09|17.6|267/304|c.1.8.3 :============================================================:BL:SWS|36->418|GUN1_ACIC1|1e-40|35.3|323/562 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|85->270|PF00150|3e-10|37.9|140/273|Cellulase 301: . . . . + .: 360 :KLKIANKLVYSIHEYPDEISDTKRWGLPEVGKGFIDRMNFTWGYLVRDNIAPVWIGEMGA:Sequence :HTTTcTTEEEEEEEETTEcccHHHHHHHcGGGTccHHHHHHHHHHHHHTTccEEEEEEEc:Sec Str :============================================================:RP:SCP|58->402|1gzjA|5e-09|17.6|267/304|c.1.8.3 :============================================================:BL:SWS|36->418|GUN1_ACIC1|1e-40|35.3|323/562 361: . . . * . .: 420 :SLRTPETREWARNLIDYMNGKYGQEGGPTFSGDQQPVSGSWWLIGPSNDPPFGLQTEWGV:Sequence :ccTTcccHHHHHHHHHHHHHTTcEEEEEEEcccccTTccccTTccTTccccGGGccHHHE:Sec Str :========================================== :RP:SCP|58->402|1gzjA|5e-09|17.6|267/304|c.1.8.3 :========================================================== :BL:SWS|36->418|GUN1_ACIC1|1e-40|35.3|323/562 421: . . + . . .: 480 :GNYRPDQIAITDEMLMRPRN :Sequence :ccccccccccccccEEcT :Sec Str