[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38352.1"

            "glycosyl transferase, WecB/TagA/CpsF family"
            ""

OrgPattern -------------------------------------------------------------------- 21-------------------1--1------1-----211------------222-----11--1---------------1-1-----11-4-111--------1-----------------------11--11--23311---1-7214331111111111123213231-1-----1----1211111-111222222221222222--11112211111-1-11111111111111111111111111111111--1-11111----111--------------------11--1-------------------------1111111111111111-111213-11--1--111111111111--111----2111------1-1111-111111-111-111111-2222231--1--111122-222----2-1-11--11111---------11--1-1--------------------------------1--1----1------------3---------2-----1---21-----1---11---11---------------------2-----------------23-2111-----1---------------------------11-1-1------111-----11-11-------------11111111111111111-1111111111111111111121111111111111111111111111111111-111111111111---1---------1-1--111---1----1--------------1----1----1111------------------11111-------211111111-1-----111111------------------------------------1111111111-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPKAQDASRNPVSDPLNAERRAEERRVAPFHVSTDSSVSFEERRVTGERRRERFQQWQRN:Sequence : XXXXXXXXXXX :SEG|18->28|aerraeerrva : XXXXXXXXXXXXXXXXXXX :SEG|41->59|eerrvtgerrrerfqqwqr 61: . . . * . .: 120 :MIGGLPIVVADRAETAKVMVDEALKRRGQWRYPAYMTSTNGEVTYRCAVDPSERAMFLEA:Sequence : ===========================:BL:SWS|94->285|TARA_BACSU|2e-23|32.1|187/257 : $$:RP:PFM|119->289|PF03808|1e-33|43.0|165/172|Glyco_tran_WecB 121: . . + . . .: 180 :DAIHADGMPHVFVSRFKCQTPLPERVATTDLFHDVAREASVRGATMFMLGADETSNRLAT:Sequence :============================================================:BL:SWS|94->285|TARA_BACSU|2e-23|32.1|187/257 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|119->289|PF03808|1e-33|43.0|165/172|Glyco_tran_WecB 181: . * . . . .: 240 :ELVKRRYPKLKLVGRRNGFFADEAEEIAACRQIAELAPDILWISMGVPREQVFIRRHRHR:Sequence :============================================================:BL:SWS|94->285|TARA_BACSU|2e-23|32.1|187/257 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|119->289|PF03808|1e-33|43.0|165/172|Glyco_tran_WecB 241: + . . . . *: 300 :LTTVGIIKTSGGLFDFLSGSKARAPQWMQRIGLEWLWRMALEPRRLGMRYLKTNPYAMYL:Sequence :============================================= :BL:SWS|94->285|TARA_BACSU|2e-23|32.1|187/257 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|119->289|PF03808|1e-33|43.0|165/172|Glyco_tran_WecB 301: . . . . + .: 360 :LLTRTR :Sequence