[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38359.1"

            "ABC transporter related"
            ""

OrgPattern MMC7CGB9KLJHJGPDaBNJHHKVsKObbRbSD7BAA7EDFB7NUHVdDNxiT7HPHMPGKAEAQ157 OTqO*WWUddeNSLSPMLL-Ld88W*LLLLLLijglv***T*X*l*fblhXM*tqLQZAAtx*a*ju***dOOOOpURSLxVg76968MLLI4LBD9--CBNEHFRHUMO55555556684444AOLDLRJGOMQKhhhtwGGFuZeddrUSfXdQRGGICHEaWUfrusV9GDEA88HBFB8dYbQMZT4QXlxxyuyw**p**zxw**pttnm***Vip*semhghcfc**QUVWVWTTUUUUUUTOOLOPnOTQjjPMTJTjiKLqtSOJRZSaYVbZcebVfekjjljieeinfjhPPRQOQQRTRRPQlZZRQQddebg*kx********b*adtuuVYZV*fbcX*YbRI**dZUWaUNYXOXdJLOXFbURRMEIFCFbQ***ROm****************-jp*id*l***L7**************HGL**********MLMMMMMMvVZFNgX*33333333322354554433435555464JFAECC***********vxy*u********i*******yBM*yq*lvkp******WlhGOCHWSHGHHHFGPNMYkiSs*LTRnaPciUSfGWXUPOUcLRXaXYhvStCDBKDDDDFED668898A888JBBHKJfemHmPUHMEmOQSSRLNYSOPRPRZQTUX5-9FTQN11----*p**Uvkknnmlolpjj-mkjknjnljjnpkghjhgk*****VZQebccddededcbdbcc*cZYfgfhL2w***********23FH9A9AAKJKKOHtk*RQRWRTDEIEFMMOVIKLJKBOCGLmWrrnrr***q**uyk***9AA8A9A9AEYbZieffffjlkjiQQOKKKKLNMBABA23KLIIFFDF78766566nBN87967-6565885GFB756684222PbbGEZmVeaBXI ----JHB-KB46CKB76856AC7D5D9AA5646CAD597858845676AC76F899A466563--2111-11-31-1--112221232-6B465554432447DB719PQPIMIaPOFAB6DMJge8h9**T3THcGFB5U9ESK8FA9ARB8*DOKIkCT*BWCP5MHJyLRHFD6D3*353A9TOV*5dT98WQRPD -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEERSAQLNYTSSSQDRPSDASAAAPPERPPLFQGLGLTKRYGDFTANSAIDIAIAPGQI:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|12->31|sssqdrpsdasaaapperpp : ========================:RP:SCP|37->248|1b0uA|1e-34|25.9|212/258|c.37.1.12 : =========================:BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510 61: . . . * . .: 120 :HALLGENGAGKSTLVKTICGLIQPDDGAMRWRGAPFAPAGPADAQACGIGLVSQHFALFD:Sequence : XXXXXXXXXXXXXXXX :SEG|93->108|gapfapagpadaqacg :============================================================:RP:SCP|37->248|1b0uA|1e-34|25.9|212/258|c.37.1.12 :============================================================:BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->193|PF00005|3e-15|39.0|118/123|ABC_tran 121: . . + . . .: 180 :NLTVAENVALGQRGGESLDILSRRLAQIAERYGLPLDPKREVWRLSVGERQRIEIVRALM:Sequence : ############### :PROS|165->179|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|37->248|1b0uA|1e-34|25.9|212/258|c.37.1.12 :============================================================:BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->193|PF00005|3e-15|39.0|118/123|ABC_tran 181: . * . . . .: 240 :QDPQFLILDEPTAVLTPAEADRLFDVLEQLRADGRALLYISHKLEEVKRLCDTATILRAG:Sequence :============================================================:RP:SCP|37->248|1b0uA|1e-34|25.9|212/258|c.37.1.12 :============================================================:BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510 :$$$$$$$$$$$$$ :RP:PFM|72->193|PF00005|3e-15|39.0|118/123|ABC_tran 241: + . . . . *: 300 :RVVAACNPRAETAASLARMMVGVDVIPPKPQPGHSIGAPRLVVNGLSLAPDDPHGVTLKQ:Sequence :======== :RP:SCP|37->248|1b0uA|1e-34|25.9|212/258|c.37.1.12 : =====================:RP:SCP|280->505|1b0uA|5e-12|12.2|223/258|c.37.1.12 :============================================================:BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510 301: . . . . + .: 360 :IDLQLRGGEIVGIAGVAGNGQDELFAALSGEAPLDEARTILIDGQAAGDLSITARRRFGA:Sequence : XXXXXXXXXXXXXX :SEG|307->320|ggeivgiagvagng :============================================================:RP:SCP|280->505|1b0uA|5e-12|12.2|223/258|c.37.1.12 :============================================================:BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510 361: . . . * . .: 420 :AFIPEQRLGHATVPTMRLSENALLTSHADPGVVRRGFVDRAALLGLVDRVTAAFGVRKAQ:Sequence :============================================================:RP:SCP|280->505|1b0uA|5e-12|12.2|223/258|c.37.1.12 :============================================================:BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510 421: . . + . . .: 480 :RDPEAERLSGGNLQKFIVGREILRQPKLLVVNQPSWGLDAGAAAAIRQALIDLAAGGAAV:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|457->475|gldagaaaairqalidlaa : ############### :PROS|428->442|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|280->505|1b0uA|5e-12|12.2|223/258|c.37.1.12 :============================================================:BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|428->455|PF00005|6e-04|35.7|28/123|ABC_tran 481: . * . . . .: 540 :LVISQDLDELLEIADSIAVMYHGRLSPPLAAAETGREQLGLLMGGSGWPQQSVHDAIPA :Sequence :========================= :RP:SCP|280->505|1b0uA|5e-12|12.2|223/258|c.37.1.12 :============================================== :BL:SWS|36->526|YUFO_BACSU|2e-72|33.8|488/510