[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38484.1"

            "FAD linked oxidase-like"
            ""

OrgPattern 22-1-13223433333113332131----111----------------13111-------12113-11 -2453--1----2-33333-332245434443333328B6134321121111143311--2352455432---------1-1311111-----1-------11-1-1111---------------1122222221266633----22222222222211122222232222-1-----1----22233--131122222222222222253111122234413--------2------------------------1111----11--21------------------------------------------------------3-121111111212-122211121-1-1--2-461121--42--1--1-321311411111227542254653544444443446-45644A4655316554459545876422144544564442222222232221226-----------------------------1146115444466686735566558756555485767771244355544636348224321-34222221222244415823334453554-212112222554544232--1111111122222222211111441--13---3-21------1-------2-1----4224------21111113213334333-233344334323433333112111111111111111111111121121111--1--------------1--111----32335---11--1111---111111113525-444444333343422332----2-----11-111111112222222222232222112-221111----------1--------------------------11---2---421 ----332-741-2422444353455543333333333534444233344456684334344423324334224243313334446312-47443323332322433-323733253321-133284152BQ5-425121-322311313231-2324155622332132233524222182221131-63312264532 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGGRGQNQARRTARMNIANPPPIVALPPELIARFAALVGDKYAVTDPAELEAYVTEERNL:Sequence : TcccccccHHccccccTccHHHHHHHHHHHHHHHcGGGEEEccccccccccccccc:Sec Str : =========================:RP:SCP|36->239|1w1oA2|7e-33|21.3|197/206|d.145.1.1 : =======================================:BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 61: . . . * . .: 120 :YRGHSPLVLRPGSTAEIAAICKLASETRVALVPQGGNTGLVGGQTPLNGEIVISLKRMDN:Sequence :TcccccEEEccccHHHHHHHHHHHHHHTccEEEEcccccTTTTTTccTTcEEEEcTTTcc:Sec Str :============================================================:RP:SCP|36->239|1w1oA2|7e-33|21.3|197/206|d.145.1.1 :============================================================:BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|68->201|PF01565|1e-16|41.4|133/139|FAD_binding_4 121: . . + . . .: 180 :IREVDTSSNTMTVEAGVILQHAQERAASVDRLFPLSLGAQGSCTIGGNLSTNAGGTAALA:Sequence :EEEEETTTTEEEEcTTccHHHHHHHHHHTTcTTTEEccccccTTccHHHHHHTTcccccT:Sec Str : XXXXXXXX:SEG|173->184|aggtaalaygla :============================================================:RP:SCP|36->239|1w1oA2|7e-33|21.3|197/206|d.145.1.1 :============================================================:BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|68->201|PF01565|1e-16|41.4|133/139|FAD_binding_4 181: . * . . . .: 240 :YGLARDMALGLEVVLADGRILNLLSKLKKDNTGYDLRDLFIGAEGTLGIITAATLKLFPK:Sequence :TccTGGGEEEEEEEETTccEEEcTTccGGGccccTTTTTcGGcccccEEEEEEEEEcEEc:Sec Str :XXXX :SEG|173->184|aggtaalaygla :=========================================================== :RP:SCP|36->239|1w1oA2|7e-33|21.3|197/206|d.145.1.1 :============================================================:BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|68->201|PF01565|1e-16|41.4|133/139|FAD_binding_4 241: + . . . . *: 300 :PRAVETAFVGLQSPADALKLLGIAQAEAAGNLTSFELIAEIALDFSVRHGHNRDPLQSRH:Sequence :cccEEEEEEEEccTTHHHHHHHHHHHHHHTTcccccEEEEHHHHHHHHccGGGTcccccc:Sec Str : ===========================================================:RP:SCP|242->489|1f0xA1|5e-37|13.1|222/237|d.58.32.2 :============================================================:BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 301: . . . . + .: 360 :PWYVLIELSSMRDDARGALEAILERGFEEGVVVDAAIATSLTQQQAFWKLREEISPAQKP:Sequence :cHHHHHHHHHHHTcccEEEEEEEEHHHHTTcTTcEEEcGGGccTTcHHHHHHHHTTTccc:Sec Str :============================================================:RP:SCP|242->489|1f0xA1|5e-37|13.1|222/237|d.58.32.2 :============================================================:BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|319->487|PF02913|7e-19|41.6|161/242|FAD-oxidase_C 361: . . . * . .: 420 :EGGSIKHDVSVPVAAVPQFIDEANAAVVGLIPGARPVPFGHLGDGNIHYNVTQPVDADKA:Sequence :cGGGEccEEcccHHHHHHHHHHHHHHHHHETHTccccEEEEEccccEEEEEEEEEETTcH:Sec Str : ###:PROS|418->429|PS00213|LIPOCALIN|PDOC00187| :============================================================:RP:SCP|242->489|1f0xA1|5e-37|13.1|222/237|d.58.32.2 :============================================================:BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|319->487|PF02913|7e-19|41.6|161/242|FAD-oxidase_C 421: . . + . . .: 480 :AFLGRWHEVNTVVFAIVMRLGGSISAEHGIGVMKRDELPGVKDQTAIELMRAIKAMLDPQ:Sequence :HHHHHHHHHHHHHHHHHHHTTcccccccGGGHHHHHHHTcHHHHHHHHHHHHHHHHHcTT:Sec Str :######### :PROS|418->429|PS00213|LIPOCALIN|PDOC00187| :============================================================:RP:SCP|242->489|1f0xA1|5e-37|13.1|222/237|d.58.32.2 :============================================================:BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|319->487|PF02913|7e-19|41.6|161/242|FAD-oxidase_C 481: . * . . . .: 540 :GIMNPGKVL :Sequence :ccccTTGGG :Sec Str :========= :RP:SCP|242->489|1f0xA1|5e-37|13.1|222/237|d.58.32.2 :========= :BL:SWS|22->489|D2HDH_RAT|2e-81|38.5|457/535 :$$$$$$$ :RP:PFM|319->487|PF02913|7e-19|41.6|161/242|FAD-oxidase_C