[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38488.1"

            "Alcohol dehydrogenase, zinc-binding"
            ""

OrgPattern 22----4555565685-412-1--41112-33------------------21-----1---2221-22 5952I224334131B54AA-A944IIAAAAA9587939GK287B73412322423321--9843D6EC8841---111---381-111-----1-------3-2-F-421------------------------2-23333---B-53241121111------1-122556------------332441--5148888888926977783212-1778332246722222145111111111111111321-22-4-22-1--155112-211213111111---11--1111-1-1111-1--1--------111---111--11-2----------12-----------1------1------1------24-678851111184B892259698634444342445-8BBA9E796F91A996899ECDCBBA563465626544822222222433-453411-11111--11-------------111-246643284668BCCCBA8788777A888749C8F8IC9-245453323768595245-12-221-111111-3424222---1-1--111-3322323134676AC-11------------------------11112532435411222223-21111112233----511------3114-232223233222-222221222222222222147453333111111111111111141112221--222222222222---111-111111-35661111---------111131412122418A6859CA855986675----------1-13-----1----3442422122-------1662244-----------------11--1------------------------33- --52AK2-451-2388DF9GBGEQQO99978A9DB68988699766FHASIMZX8CFA8998A47341-4133131111212333576-FRAD9C855619179A7-78BF7A77954534395774B5LtB1CAA3343937C4155447129478568961C8413355217B-122S1-15CFESODDE33RFDJ3 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPV:Sequence :cEEEEEcccccGGGEEEEEEcccccccTTEEEEEEEEEEccHHHHHHHHTcccTTccccE:Sec Str :============================================================:RP:SCP|1->149|1iyzA1|4e-18|32.0|122/131|b.35.1.2 : ===========================================================:BL:SWS|2->338|VAT1_DANRE|9e-29|30.4|313/484 61: . . . * . .: 120 :IMGLDVAGEIVKVGEGVEGWKAGDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVR:Sequence :EcccEEEEEEEEEccccccccTTcEEEEcGGGcTTcEETTTccccccccEEEEEGGGEEE:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|66->83|vageivkvgegvegwkag :============================================================:RP:SCP|1->149|1iyzA1|4e-18|32.0|122/131|b.35.1.2 :============================================================:BL:SWS|2->338|VAT1_DANRE|9e-29|30.4|313/484 121: . . + . . .: 180 :IPDNVSFEQAAALPVAYGTAHRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYV:Sequence :ccTTccHHHHHHcHHHHHHHHHHHTTTccccTTcEEEEccTTcTTHHHHHHHHHHTTcEE:Sec Str : ###################### :PROS|153->174|PS01162|QOR_ZETA_CRYSTAL|PDOC00058| :============================= :RP:SCP|1->149|1iyzA1|4e-18|32.0|122/131|b.35.1.2 : =======================================================:RP:SCP|126->306|1o89A2|1e-28|21.7|166/177|c.2.1.1 :============================================================:BL:SWS|2->338|VAT1_DANRE|9e-29|30.4|313/484 : $$$$$$$$$$$$$$$$$:RP:PFM|164->286|PF00107|5e-12|42.9|112/128|ADH_zinc_N 181: . * . . . .: 240 :IACAGSEEKGQRLKEVGADEVILYTKEDFMQVVRQRHGRPQRVGGGSSENGGVDVVVNFT:Sequence :EEEEccHHHHHHHHHHTccEEEETTcTTHHHHHHHHTTTTccccTHHHTTccEEEEEEcc:Sec Str :============================================================:RP:SCP|126->306|1o89A2|1e-28|21.7|166/177|c.2.1.1 :============================================================:BL:SWS|2->338|VAT1_DANRE|9e-29|30.4|313/484 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|164->286|PF00107|5e-12|42.9|112/128|ADH_zinc_N 241: + . . . . *: 300 :GGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFELQVRGSNGWERDDIEKLFAL:Sequence :ccccHHHHHHHEEEEEEEEEccccccccccccTTHHHHTTcEEEEcccccGGGHHHHHHH:Sec Str :============================================================:RP:SCP|126->306|1o89A2|1e-28|21.7|166/177|c.2.1.1 :============================================================:BL:SWS|2->338|VAT1_DANRE|9e-29|30.4|313/484 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|164->286|PF00107|5e-12|42.9|112/128|ADH_zinc_N 301: . . . . + .: 360 :LASGKLRAQVDKAFPLEQAADALRMLEDRTVFGKVVVTP :Sequence :HHHTcccccEEEEEEGGGHHHHHHHHHTTccccEEEEEc :Sec Str :====== :RP:SCP|126->306|1o89A2|1e-28|21.7|166/177|c.2.1.1 :====================================== :BL:SWS|2->338|VAT1_DANRE|9e-29|30.4|313/484