[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38511.1"

            "Pseudouridine synthase, Rsu"
            ""

OrgPattern -------------------------------------------------------------------- 1221111111111111111-11111111111111111111111111111111112111--11111111111-1111111111121222111111-11--21333133312-1111111-11111111111111111111111111122122222222222212112222221211111211111112222-222-4444444344444422222244422232332222223322222222222222222222-21111111222211112222213333323333322222222222222333333333333333333333323324222222242422223233232122221122131111222222-21111333211111121111111111111111111111-3322212112112111222222221144121111112221111111111111222------------1111111111111-----1212-2222232232333333333233333333332333322232333332322532434453334333322233421112111111111111111121111113111211111111111111111112111233342344624544555445634435-66366--2111211111143332444443444444-4444444444444444444444333344444444444444444544434442-433343333444--2211111222224224333323232233222222222244322444433334-33333331111111113444544444445444455355454111111122211111111111121311111-11111--11111--12---2212211111123 11--21--311-------------------------------------------------------------------------------------------------911-----111111111212-252-122111-111111111121-21---2----3---------1-1-13C3331111-1-11323222- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPRDTDKNNASARGRRDRPGGGKTSSGGKGGFGGKGGFGGKSAGGGKGRSGAARGPEKKF:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|20->55|gggktssggkggfggkggfggksagggkgrsgaarg 61: . . . * . .: 120 :AKRGEGTFEARADKPFAKKTFGGDAKRAFGGEGKRPYVKRDGAAPRRDFADRPRRDDGDA:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXX:SEG|100->125|rdgaaprrdfadrprrddgdaprprf 121: . . + . . .: 180 :PRPRFNRDERPARSGGDRPERGPRKEFGEKRAFAPREGGEKRPYTPRPPRDDRGGDRPFK:Sequence : :Sec Str :XXXXX :SEG|100->125|rdgaaprrdfadrprrddgdaprprf : XXXXXXXXXXXXXXXXXXX:SEG|162->211|rpytprpprddrggdrpfkrddraprrdrgddarpagrfgdkkfgdkkfg 181: . * . . . .: 240 :RDDRAPRRDRGDDARPAGRFGDKKFGDKKFGEKRPYTPREGGDKRPYTPREGGEKRPYTP:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|162->211|rpytprpprddrggdrpfkrddraprrdrgddarpagrfgdkkfgdkkfg : ===========================:BL:SWS|214->307|IF2_DESRM|9e-16|55.1|89/985 241: + . . . . *: 300 :REGGEKRPYAAREGGEKRPYTPRDGGEKRSYAPREGGDKRPYTPRGEGFRKDGERSRPTG:Sequence : :Sec Str :============================================================:BL:SWS|214->307|IF2_DESRM|9e-16|55.1|89/985 301: . . . . + .: 360 :DRPFGARPSRDGKFGGDKKFGRGAPDRGPRKDFGSRPDRGGDRGDAKPWQKRDGDSAERG:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|310->323|rdgkfggdkkfgrg : XXXXXXXXXX :SEG|336->345|rpdrggdrgd :======= :BL:SWS|214->307|IF2_DESRM|9e-16|55.1|89/985 361: . . . * . .: 420 :RSFDKPRFDKPREERGGDRPRFSRDDRPKFERRERTGDWHEHPRNEGPSSDRPRSRDNGE:Sequence : cccccccTTcccccc ccccccccccccccccc:Sec Str : =========================================================:BL:SWS|364->434|Y955_SYNY3|3e-04|47.3|55/384 421: . . + . . .: 480 :RGFDRPRRENEDESKIFAKRPAFGGRGAYRERPKTDRSKTERRAAPAPAKADKAGDRIAK:Sequence :cccccccccTTHHHHTTHHHHHHHHTccHHHHHHHHHHHHHccccTTTTTTHHHcEEHHH:Sec Str : XXXXXXXXXXX :SEG|464->474|aapapakadka : ====:RP:SCP|477->530|1vioA2|9e-14|24.1|54/58|d.66.1.5 :============== :BL:SWS|364->434|Y955_SYNY3|3e-04|47.3|55/384 : ====:BL:SWS|477->704|Y321_RICBR|1e-54|46.9|226/229 481: . * . . . .: 540 :VVARAGLCSRRDAEAWIVEGRVAVNGRVIDSPALDVTYSDVITVDGKPLPERERTRLFLY:Sequence :HHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcTTccEEETTEEEccccGGGccEEE:Sec Str :================================================== :RP:SCP|477->530|1vioA2|9e-14|24.1|54/58|d.66.1.5 : =====:RP:SCP|536->687|1kskA4|7e-30|30.9|149/172|d.265.1.3 :============================================================:BL:SWS|477->704|Y321_RICBR|1e-54|46.9|226/229 : $$$$$:RP:PFM|536->613|PF00849|7e-09|47.4|78/149|PseudoU_synth_2 541: + . . . . *: 600 :HKPRGLMTTHADPEGRPTVFDNLPEDLPRLISIGRLDFNTEGLLLLTNDGGLARALELPE:Sequence :EEEcTTcccccccccTTcHHHHHTccccccEEcccccTTcEEEEEEEccTTHHHHHHcGG:Sec Str : ############### :PROS|574->588|PS01149|PSI_RSU|PDOC00885| :============================================================:RP:SCP|536->687|1kskA4|7e-30|30.9|149/172|d.265.1.3 :============================================================:BL:SWS|477->704|Y321_RICBR|1e-54|46.9|226/229 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|536->613|PF00849|7e-09|47.4|78/149|PseudoU_synth_2 601: . . . . + .: 660 :TGWLRRYRVRAHGEVTQAQLDQLASGVEVDGVKYGPIEAKLERDQGANVWLVFAIREGKN:Sequence :GcccEEEEEEEcccccHHHHHHHHTccccccccccccEEEcEEEEccccEEEEEEccccT:Sec Str :============================================================:RP:SCP|536->687|1kskA4|7e-30|30.9|149/172|d.265.1.3 :============================================================:BL:SWS|477->704|Y321_RICBR|1e-54|46.9|226/229 :$$$$$$$$$$$$$ :RP:PFM|536->613|PF00849|7e-09|47.4|78/149|PseudoU_synth_2 661: . . . * . .: 720 :REVRNVLAHLGLEVNRLIRVSYGPFQLLEIEEGQVEEVKTRVLREQLGEKIIKLAEADFG:Sequence :THHHHHHHHTTccEEEEEEEEETTEEcTTccTTcEEEccHHHHHEEGGGccTTccEEEE :Sec Str :=========================== :RP:SCP|536->687|1kskA4|7e-30|30.9|149/172|d.265.1.3 :============================================ :BL:SWS|477->704|Y321_RICBR|1e-54|46.9|226/229 721: . . + . . .: 780 :GPSPSETRPKPRPGKPVAAEDGPAPKKKAVVKRGAVEDRKGRKVKVERTGSGDRDPSRGP:Sequence : cTTTHH HHTTcccEETTTcccccccccccEEEEEETTcc :Sec Str 781: . * . . . .: 840 :ARRYHGKREPAPRED :Sequence : :Sec Str