[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38555.1"

            "Carotenoid oxygenase"
            ""

OrgPattern ----------------------------1--------------------------------------- ----2---------13322-23--2322222252221121-1------------------------2-1---------------------------------------1-------------------------------------4542332111111111122124332111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2221-------111---11111-------------------1--1----1------------1------------------------1-------------------------------13-2------111111-1111----11111-11----1--111------1--1------------------------------------------11--------------------------------------------------11111---------------------------------------------------------------------1--------------------------------------------1--1-------------------------------------------1---------------------------------1---1-------------------------------------------------------------------- ---------------222121--4332------1-1-111111---22--14A621211111------------------------------2-------1-2-----21136113-----12122-1-6B3-2321--11-1-11--112--1-112411--1----1----5-1346H66645695Q17E22----2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLQVTGIPDACDNLAPIPMECDAPSLPIKGELPRELNGTLYRNGANPQFASPNAHWFFGD:Sequence : TTccccccEEEEcccEEEcccTTccEEEEEccccccEEEEcccGGGcc:Sec Str : ================================================:BL:SWS|13->464|CCD_CROSA|4e-54|34.5|447/546 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->466|PF03055|3e-78|43.7|449/462|RPE65 61: . . . * . .: 120 :GMLHAFRLENGRASYRNRWVRTPKWLAEHAAGRPLYGEFNLKLPDAPRSAPDDGNVANTN:Sequence :cEEEEEEEcccccEEEEEEcccHHHHHHHHHTcccccTTccccccTHHHHTTcccccccE:Sec Str :============================================================:BL:SWS|13->464|CCD_CROSA|4e-54|34.5|447/546 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->466|PF03055|3e-78|43.7|449/462|RPE65 121: . . + . . .: 180 :IVFHAGRLLALEEAHLPIEIERDTLATRGYCDYGGALKGPFTAHPKIDPVTGEMLFFGYN:Sequence :EEEETTEEEEEcTTcccEEEcTTTccEEEEccTTTTcTcccccccEEEcccTTcEEEEEE:Sec Str :============================================================:BL:SWS|13->464|CCD_CROSA|4e-54|34.5|447/546 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->466|PF03055|3e-78|43.7|449/462|RPE65 181: . * . . . .: 240 :AAGPLKRTMSFGAIDASGHVTRFEYFKAPYAAMVHDFIVTENYVLFPILPLTGSIWRAMR:Sequence :EEEccEEEEEEEEEcTTccEEEEEEEEEEccccccccEEcccEEEEEEccEEHHHTTccc:Sec Str :============================================================:BL:SWS|13->464|CCD_CROSA|4e-54|34.5|447/546 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->466|PF03055|3e-78|43.7|449/462|RPE65 241: + . . . . *: 300 :GRPPYAWDPGKGSYVGVMKRTGTTRDIRWFRGDACFVFHVMNAWEDGTKIVADVMQSEEA:Sequence :GGGGEEEcTTccEEEEEEETTccccccEEEEEcccEEEEEEEEEEETTEEEEEEEEEccc:Sec Str : ===================================:RP:SCP|266->351|3btaA3|9e-10|19.3|83/528|d.92.1.7 :============================================================:BL:SWS|13->464|CCD_CROSA|4e-54|34.5|447/546 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->466|PF03055|3e-78|43.7|449/462|RPE65 301: . . . . + .: 360 :PLFTHPDGRRTDPEKGRARLCRWSFDLAGNTNAFKRSYLDDISGEFPRIDERRAGLRSGH:Sequence :cccTcTTccGGGccGcccEEEEEEEETTTcTTEEEEEEEEcccEEEEEccGGGTTccccE:Sec Str :=================================================== :RP:SCP|266->351|3btaA3|9e-10|19.3|83/528|d.92.1.7 :============================================================:BL:SWS|13->464|CCD_CROSA|4e-54|34.5|447/546 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->466|PF03055|3e-78|43.7|449/462|RPE65 361: . . . * . .: 420 :GWYACASPETPMLGMLTGLVHVDGNGHRRARYLLPTGDTIGEPVFVPRKPDSAEADGWLL:Sequence :EEEEEccccccccccccEEEEEETTTTEEEEEEcTTTEEccccEEEEcTTcccTTcEEEE:Sec Str :============================================================:BL:SWS|13->464|CCD_CROSA|4e-54|34.5|447/546 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->466|PF03055|3e-78|43.7|449/462|RPE65 421: . . + . . .: 480 :TVIWRSCENRSDLAVFNAADIAGGPIALVQLGHRVPDGFHGNWVAAG :Sequence :EEEEETTTTEEEEEEEETTcTTccccEEEEccccccccccEEEEcT :Sec Str :============================================ :BL:SWS|13->464|CCD_CROSA|4e-54|34.5|447/546 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|12->466|PF03055|3e-78|43.7|449/462|RPE65