[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38556.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----------------------------------------11-1111----------------------------------------------------------------------------------------------------------1--------------------------11-----111111-1---------------------------------1-------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPEAAALYCHRGTRAIQRMVEFAPSTGGLALWVRHQDLPADSDVAPVAFTDGTVVYYGAA:Sequence : :Sec Str : $$$$$$:RP:PFM|55->457|PF09967|9e-21|37.7|324/344|DUF2201 61: . . . * . .: 120 :FERLPLPEQVGLVAHEVLHIALRHPQRFVELQRVIGDVDLELFNICADAIVNSTLAHLSW:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->457|PF09967|9e-21|37.7|324/344|DUF2201 121: . . + . . .: 180 :LTLPAKSVMLEQILAKALKREQEAEAALLEWDVEKLYRAIDDRDTDSNNGKSKSGNKSRA:Sequence : :Sec Str : XXXXXXXXXXXXXX:SEG|167->211|snngksksgnksragsqadasgsggrdqsrsqssseqqsaeqrad :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->457|PF09967|9e-21|37.7|324/344|DUF2201 181: . * . . . .: 240 :GSQADASGSGGRDQSRSQSSSEQQSAEQRADGARSAKVRELGAGGVRDLVPNPESQSAPE:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|167->211|snngksksgnksragsqadasgsggrdqsrsqssseqqsaeqrad :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->457|PF09967|9e-21|37.7|324/344|DUF2201 241: + . . . . *: 300 :HEAEHAREWSERILRGHAGDGAFSMLRALIADLPHTRTPWAQVLRVQLARGLARKPSLTW:Sequence : :Sec Str : ================================:BL:SWS|269->423|Y929_THEMA|2e-09|32.2|152/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->457|PF09967|9e-21|37.7|324/344|DUF2201 301: . . . . + .: 360 :SRPARSYIANQGRAGQHRMPFEPGFCATKNEPRLALIIDVSGSIDEGLMERFAREIETIT:Sequence : cccccccccccEEEEEEccTTccHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|269->423|Y929_THEMA|2e-09|32.2|152/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->457|PF09967|9e-21|37.7|324/344|DUF2201 361: . . . * . .: 420 :RRQEAGLVLIIGDERVRQVEFFEPGRRFVLSEIEFAGGGGTDFTPLLAEADRHRPDIAVV:Sequence :HTccccEEEEEEcccEEEEEcTTcccHHHHHTccccccccccHHHHHHHHHHTcEEEEEE:Sec Str :============================================================:BL:SWS|269->423|Y929_THEMA|2e-09|32.2|152/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->457|PF09967|9e-21|37.7|324/344|DUF2201 421: . . + . . .: 480 :LTDLEGPADFKPRWPVIWAVPESHANAVQPFGRLLTLN :Sequence :EEcccccGGGGTT :Sec Str :=== :BL:SWS|269->423|Y929_THEMA|2e-09|32.2|152/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|55->457|PF09967|9e-21|37.7|324/344|DUF2201