[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38586.1"

            "Poly-beta-hydroxybutyrate polymerase-like"
            ""

OrgPattern ------------------------1--111------------------------------------11 --------------------------------------31------------------------------------------2-----------------------------------------------------11111-------11--1-----------1-----------------------------111111111111111------111-----------------------------------------------------------------------------------------------------------------------------------1-----------3--------------3112-----3252411222222------------12411311113-111111221111221212132222112--------2---2222-------------122--1--1--1-----2211-1111121121222122222322221222322231122122112122211214----11----------533--1-------------------------1------------------------------111-211-----------1------1--------531--------------------------------------------------------------------------------------------------2444-231----------------111111----2-2222222222222112--------------211111111111111111111------1-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1--------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLQTPSNPIAVAPQAPVRHVGSTDSDRSLHAALAPLTGGLSPTALSLAYADWLSHLFWAP:Sequence : :Sec Str : XX:SEG|59->87|aparrldlaqdalrgaaqlaqaavhpapp : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|26->56|PF12551|4e-08|71.0|31/46|PHBC_N 61: . . . * . .: 120 :ARRLDLAQDALRGAAQLAQAAVHPAPPWSLITPQPQDRRFAGPEWRQPPFNLMAQSFLLA:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|59->87|aparrldlaqdalrgaaqlaqaavhpapp : ==========================:BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583 : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|95->264|PF07167|7e-48|52.1|169/169|PhaC_N 121: . . + . . .: 180 :EEWWRDATTGIRGVSQQNAKIVEFAMRQMLDVFAPSNFALTNPEVIRRTLTSEGGNVTAG:Sequence : :Sec Str :============================================================:BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|95->264|PF07167|7e-48|52.1|169/169|PhaC_N 181: . * . . . .: 240 :LRNWWEDLLQTMSHDTDLKHDFEVGRDVAVTPGKVVYSNDLIELIQYAPATGEVRPEPIL:Sequence : HHHHHHHHHHHTcTTccccccGGGGccGGGcccc:Sec Str : ===================:RP:SCP|222->561|1ju3A2|4e-14|10.6|312/347|c.69.1.21 :============================================================:BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|95->264|PF07167|7e-48|52.1|169/169|PhaC_N 241: + . . . . *: 300 :IVPAWIMKYYILDLSPHNSLVKYLTEQGFTVFMVSWRNPTAKHRDLTLEDYRRLGVMAAI:Sequence :cEEEEEETccEEEEcTTccEEEEEcTTccEEEEEGGGccGGGHHHHHHHHHHHHHcccTT:Sec Str :============================================================:RP:SCP|222->561|1ju3A2|4e-14|10.6|312/347|c.69.1.21 :============================================================:BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|95->264|PF07167|7e-48|52.1|169/169|PhaC_N 301: . . . . + .: 360 :ETIRAIVPHQPIHAVGYCLGGTLLSIAAAAMSRDGDDRLRSITLFAAQTDFTEAGELTLF:Sequence :TTcccccccccHcEEEEEEETTEEEEEETHHHHTccEEEEETTETccEEEEETTTTEEEE:Sec Str :============================================================:RP:SCP|222->561|1ju3A2|4e-14|10.6|312/347|c.69.1.21 :============================================================:BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583 361: . . . * . .: 420 :INESQVAFLEDMMWKRGVLDTTQMAGAFQILRSNDLVWSRMVRDYLMGERSEPNDLMAWN:Sequence :EcTTccHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHcccTTccccccTTTTTTTTcccc:Sec Str :============================================================:RP:SCP|222->561|1ju3A2|4e-14|10.6|312/347|c.69.1.21 :============================================================:BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583 421: . . + . . .: 480 :ADATRMPYRMHSEYLRKLFLDNDLAEGRYTVDDRAIALSDIHTPMFVVGTLRDHVAPWRS:Sequence :cccccccccccccHHHHHHHHHHHHHHTHHHHHGGGTTccccccEEEEEETTcccccGGG:Sec Str :============================================================:RP:SCP|222->561|1ju3A2|4e-14|10.6|312/347|c.69.1.21 :============================================================:BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583 481: . * . . . .: 540 :TFKIHLLADAEITFCLTGGGHNAGIVSPPSPKAHGYQVMMKEADGPYIGPDDWIKEAPHA:Sequence :GTTGGGTcTTcEEEEEccccccHHHHcH :Sec Str :============================================================:RP:SCP|222->561|1ju3A2|4e-14|10.6|312/347|c.69.1.21 :============================================================:BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583 541: + . . . . *: 600 :EGSWWTEWVHWLEARSGQPVPPPRIGLPDTNAAELPDAPGHYVLQA :Sequence : :Sec Str :===================== :RP:SCP|222->561|1ju3A2|4e-14|10.6|312/347|c.69.1.21 :=========================================== :BL:SWS|95->583|PHBC_AZOC5|e-114|42.8|481/583