[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38614.1"

            "Sulfate ABC transporter, permease protein CysW"
            ""

OrgPattern --111111-------1-------1123222321-11-25555312144-1532-2423312---1--- --1111112221-143333-33--343333333333334411112221311-2121-1--11212112211--------121311111----11-----------1-11----------------1212212321211121--15224333332255------33233331------------111---1-5-132323443333342354221133515241--------85111111111111111211112----------------------------------------------------------------------211322211211121333-12-3-21132341442-22-2-11--1--2---3333-----33586336455556666666566A-44433334224-588475663767C81---49576643222222222-33-2533--------------------------------1--455345557653344466654434247487454--554322334383457781233352333333222342-24242221-4221-43113435-31334212312111111-1-111111111231111432141-11--24444112444526215112---22-------33331343555355544-5434454333544233325656663345454555554555545555323432-47767777777722-2---------4141633332311111111233323234425533334334544443555----------2223555554325411333333332222--12222222--------1----------------------------22-------13- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222-----12---1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNPQPANKDWMVTPVGAGPVARFIVLSVVAVVTLFILIAPLAVILSSAFAQGVGVFLRN:Sequence : HHHH:Sec Str : ======================================:BL:SWS|23->251|CYSW_ECOLI|2e-76|55.5|229/291 61: . . . * . .: 120 :LGDPGTLHAMWLTTITALIAVPINILFGVAAAWTVTKFEFPGRTLLIALIELPYSISPIV:Sequence :HHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHH:Sec Str : ==========================================================:RP:SCP|63->251|2r6gG1|5e-21|19.2|182/284|f.58.1.1 :============================================================:BL:SWS|23->251|CYSW_ECOLI|2e-76|55.5|229/291 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|78->251|PF00528|9e-05|33.3|162/195|BPD_transp_1 121: . . + . . .: 180 :AGVAYLFVYGSQGLFGPLLDQLDLKVMFALPGIVLASMFVTAPYVARELIPLMQVQGTDE:Sequence :HHHHHHHHHcTTcTTTTTGTTcccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHccHHH:Sec Str :============================================================:RP:SCP|63->251|2r6gG1|5e-21|19.2|182/284|f.58.1.1 :============================================================:BL:SWS|23->251|CYSW_ECOLI|2e-76|55.5|229/291 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|78->251|PF00528|9e-05|33.3|162/195|BPD_transp_1 181: . * . . . .: 240 :EEAAVTLGAGGFATFFRVTLPNIRWAMLYGAILCNARVLGEFGAVSVVSGNVRGQTTTLP:Sequence :HHHHHHTTccHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHccHHHHTTc :Sec Str :============================================================:RP:SCP|63->251|2r6gG1|5e-21|19.2|182/284|f.58.1.1 :============================================================:BL:SWS|23->251|CYSW_ECOLI|2e-76|55.5|229/291 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|78->251|PF00528|9e-05|33.3|162/195|BPD_transp_1 241: + . . . . *: 300 :LQIELLYQDYNVAGAFAAATTLTAVAVVTILLKMLLERLAGDERPQP :Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|252->269|vagafaaattltavavvt :=========== :RP:SCP|63->251|2r6gG1|5e-21|19.2|182/284|f.58.1.1 :=========== :BL:SWS|23->251|CYSW_ECOLI|2e-76|55.5|229/291 :$$$$$$$$$$$ :RP:PFM|78->251|PF00528|9e-05|33.3|162/195|BPD_transp_1