[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE38614.1 rpal2 ABE38614.1 "Sulfate ABC transporter, permease protein CysW"
MSNPQPANKDWMVTPVGAGPVARFIVLSVVAVVTLFILIAPLAVILSSAFAQGVGVFLRN
LGDPGTLHAMWLTTITALIAVPINILFGVAAAWTVTKFEFPGRTLLIALIELPYSISPIV
AGVAYLFVYGSQGLFGPLLDQLDLKVMFALPGIVLASMFVTAPYVARELIPLMQVQGTDE
EEAAVTLGAGGFATFFRVTLPNIRWAMLYGAILCNARVLGEFGAVSVVSGNVRGQTTTLP
LQIELLYQDYNVAGAFAAATTLTAVAVVTILLKMLLERLAGDERPQP
//