[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38720.1"

            "Glyoxalase/bleomycin resistance protein/dioxygenase"
            ""

OrgPattern -------------------------------------------------------------------- -----------------11-11--111111111---1111-1----------------------1-------------------------------------------------------------------------------1----------11-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111--------111---1-11----------------------1---------------1121---------2----------------------------------------------1111---------1-----------------2-111-1----12-111212-13--1----------------11--------------------------------1---------------------------------1-1-------------------11--------------------------------------------------------------------------1------------------------1-----------------------------111111--111---------------------------------------------1-11------------------------------------------------------------------ ------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGN:Sequence :cccEcccEEEEEcccHHHHHHHHTHHHccEEcccEEEGTTTEEGGGGTEEEEEEEccccc:Sec Str :============================================================:RP:SCP|1->136|1zswA1|3e-17|22.3|130/144|d.32.1.10 : =================:BL:SWS|44->163|FOSB_BACSK|7e-06|35.6|118/146 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->133|PF00903|1e-10|37.7|114/120|Glyoxalase 61: . . . * . .: 120 :ILAFFELPNSPPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFK:Sequence :EEEEEETTccccccccccccccEEEEcccHHHHHHHHHHHHHHHHTTccEEEEEcTTccE:Sec Str : #######:PROS|114->133|PS00082|EXTRADIOL_DIOXYGENAS|PDOC00078| :============================================================:RP:SCP|1->136|1zswA1|3e-17|22.3|130/144|d.32.1.10 :============================================================:BL:SWS|44->163|FOSB_BACSK|7e-06|35.6|118/146 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->133|PF00903|1e-10|37.7|114/120|Glyoxalase 121: . . + . . .: 180 :SIYFWDPSGHRLEVAAWTATPQQLAQMKDVAHAMVDEWAETKKPPRHTAWLHQKEFADAK:Sequence :EEEEEcTTccEEEEEccccccccHHHHHEEEcTTccccccTTcEEEEHHHHHHHTc :Sec Str :############# :PROS|114->133|PS00082|EXTRADIOL_DIOXYGENAS|PDOC00078| :================ :RP:SCP|1->136|1zswA1|3e-17|22.3|130/144|d.32.1.10 :=========================================== :BL:SWS|44->163|FOSB_BACSK|7e-06|35.6|118/146 :$$$$$$$$$$$$$ :RP:PFM|5->133|PF00903|1e-10|37.7|114/120|Glyoxalase