[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABE38720.1 rpal2 ABE38720.1 "Glyoxalase/bleomycin resistance protein/dioxygenase"
MQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGN
ILAFFELPNSPPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFK
SIYFWDPSGHRLEVAAWTATPQQLAQMKDVAHAMVDEWAETKKPPRHTAWLHQKEFADAK
//