[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rpal2:ABE38755.1"

            "ABC transporter related"
            ""

OrgPattern UTIAMJGIPONLOJQJhHTPKPMatNScmQeWLAFDF9HGFEBSZRVlKQ*xe9NYMSWOPNGBW18A PXsI*ZWaiikLWUVQOON-Ni99W*OOOOOOrkklu***V*U*o*rfqjbR*zyNObDEnp*g*p****baVVVxaYdO*fnB8B8CRQOJ6KFKF-1HETLKKZLVOS4666666ABA8888HQPKUYNLTVWRnsr**MLJ*aqgnvbbiffVWPFNHNHffYm***aHMFIJJJOGJCIiYYVTjeAWcv********u********wwyy***Znv**hhustrsq**YfffefcbedfffddUYUVWubaXvvVOXUeutKL*yeTSUifdfgkjntpktwqpswrrlosuqsqcbaaZcabdaaaYvlkZYaompoi*z*********c*gt***YcdZ*lipk*flQM**tkcbhnRYjZpjPVZbKcTQQKIKHHNeW***YSr****************-kr*je*o***QA**************GKJ**********MLMMMMMM*WaJTiW*77456555545569AB6689586697475KEDEDE***********y*z*w********l********BP**w*ixpu******XnlMYLLlUHJIIJHJNNScqkX**QdRymZnvXWkKaYZTSYjUXVWXXn*Y*IKKQFIHHKGF587786667EOEDINMpotSvTcISOqNQRTQLRaOLNQRUXXTWZ5-CIWLN211222*x**X*wu**yvyuytu-*utvzsxvvv*xwrstrrq*****ikenkjmknmmnkjknkmk*nhjoppsR4************23KGEHEEFLLONMG*m*UUVYTUHNOMLRLQZMOPQOHSIQTkbvvtuy***r**zxk***FDCACCCBDLfnm*knmln**yxwOPOMMMMJLKAAAA54NTQQJJKK78796898*CWCAACA-A8BCHFCMLIBBJ9AE666VklOQi*ijiFaN -111SQJ-OE79GSKFFDBABFDFCFDCC7858EGG8BB989A888C7CDFCODFED67A8A77C5742544A59321236976CB13-8A4F7778865737HCD1MUVVKQITRRHDA5ELHfb5g7**b4aOcGFF6X9ETU9ICAAU89*BSMKrFZ*HgKU7*TT*SYQEFGF7*AB9DFmST*BumIG*u**K -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEI:Sequence : ==========================================================:RP:SCP|3->250|1b0uA|4e-45|25.9|247/258|c.37.1.12 : ==========================================================:BL:SWS|3->252|BRAF_PSEAE|8e-69|49.2|250/255 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->180|PF00005|1e-11|32.5|123/123|ABC_tran 61: . . . * . .: 120 :RLGGELVSGLAPHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPS:Sequence :============================================================:RP:SCP|3->250|1b0uA|4e-45|25.9|247/258|c.37.1.12 :============================================================:BL:SWS|3->252|BRAF_PSEAE|8e-69|49.2|250/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->180|PF00005|1e-11|32.5|123/123|ABC_tran 121: . . + . . .: 180 :LRRADAVLREHAAELMVYVGLEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAA:Sequence :============================================================:RP:SCP|3->250|1b0uA|4e-45|25.9|247/258|c.37.1.12 :============================================================:BL:SWS|3->252|BRAF_PSEAE|8e-69|49.2|250/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->180|PF00005|1e-11|32.5|123/123|ABC_tran 181: . * . . . .: 240 :GFNPKETAEIDNLVRKIADSGITVVLVEHDMKMVMNISDRILVLNYGRKLTEGSARDVRD:Sequence :============================================================:RP:SCP|3->250|1b0uA|4e-45|25.9|247/258|c.37.1.12 :============================================================:BL:SWS|3->252|BRAF_PSEAE|8e-69|49.2|250/255 241: + . . . . *: 300 :NPEVIAAYLGTAA :Sequence :========== :RP:SCP|3->250|1b0uA|4e-45|25.9|247/258|c.37.1.12 :============ :BL:SWS|3->252|BRAF_PSEAE|8e-69|49.2|250/255